diff --git a/_autosummary/poli.core.abstract_benchmark.html b/_autosummary/poli.core.abstract_benchmark.html index 6009ec2d..8bea49e8 100644 --- a/_autosummary/poli.core.abstract_benchmark.html +++ b/_autosummary/poli.core.abstract_benchmark.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_black_box.AbstractBlackBox.html b/_autosummary/poli.core.abstract_black_box.AbstractBlackBox.html index 768e2b8c..12364e06 100644 --- a/_autosummary/poli.core.abstract_black_box.AbstractBlackBox.html +++ b/_autosummary/poli.core.abstract_black_box.AbstractBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_black_box.NegativeBlackBox.html b/_autosummary/poli.core.abstract_black_box.NegativeBlackBox.html index 1c27d46b..9c31ba96 100644 --- a/_autosummary/poli.core.abstract_black_box.NegativeBlackBox.html +++ b/_autosummary/poli.core.abstract_black_box.NegativeBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_black_box.html b/_autosummary/poli.core.abstract_black_box.html index 46a7568d..2b8f30cd 100644 --- a/_autosummary/poli.core.abstract_black_box.html +++ b/_autosummary/poli.core.abstract_black_box.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_isolated_function.html b/_autosummary/poli.core.abstract_isolated_function.html index 20b77e78..a4fee49a 100644 --- a/_autosummary/poli.core.abstract_isolated_function.html +++ b/_autosummary/poli.core.abstract_isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory.html b/_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory.html index 5fb2cc7a..2eaf1582 100644 --- a/_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory.html +++ b/_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory.html b/_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory.html index 0ab45fac..660f5e10 100644 --- a/_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory.html +++ b/_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.abstract_problem_factory.html b/_autosummary/poli.core.abstract_problem_factory.html index 9f150004..fcfcee0f 100644 --- a/_autosummary/poli.core.abstract_problem_factory.html +++ b/_autosummary/poli.core.abstract_problem_factory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.benchmark_information.html b/_autosummary/poli.core.benchmark_information.html index 6d878526..164124af 100644 --- a/_autosummary/poli.core.benchmark_information.html +++ b/_autosummary/poli.core.benchmark_information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.black_box_information.html b/_autosummary/poli.core.black_box_information.html index 805f2a13..274e3d5f 100644 --- a/_autosummary/poli.core.black_box_information.html +++ b/_autosummary/poli.core.black_box_information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.chemistry.html b/_autosummary/poli.core.chemistry.html index e6e584f7..3afc52b3 100644 --- a/_autosummary/poli.core.chemistry.html +++ b/_autosummary/poli.core.chemistry.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox.html b/_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox.html index a285f559..4a57fc64 100644 --- a/_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox.html +++ b/_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.chemistry.tdc_black_box.html b/_autosummary/poli.core.chemistry.tdc_black_box.html index 367dc19d..be743b47 100644 --- a/_autosummary/poli.core.chemistry.tdc_black_box.html +++ b/_autosummary/poli.core.chemistry.tdc_black_box.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.chemistry.tdc_isolated_function.html b/_autosummary/poli.core.chemistry.tdc_isolated_function.html index a9cabc21..c3e1d805 100644 --- a/_autosummary/poli.core.chemistry.tdc_isolated_function.html +++ b/_autosummary/poli.core.chemistry.tdc_isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.exceptions.BudgetExhaustedException.html b/_autosummary/poli.core.exceptions.BudgetExhaustedException.html index 2ef3701a..ce810767 100644 --- a/_autosummary/poli.core.exceptions.BudgetExhaustedException.html +++ b/_autosummary/poli.core.exceptions.BudgetExhaustedException.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.exceptions.PoliException.html b/_autosummary/poli.core.exceptions.PoliException.html index 505ba114..a2f5389b 100644 --- a/_autosummary/poli.core.exceptions.PoliException.html +++ b/_autosummary/poli.core.exceptions.PoliException.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.exceptions.html b/_autosummary/poli.core.exceptions.html index 042367e9..15efb67f 100644 --- a/_autosummary/poli.core.exceptions.html +++ b/_autosummary/poli.core.exceptions.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.html b/_autosummary/poli.core.html index 800c1ae1..88bbe076 100644 --- a/_autosummary/poli.core.html +++ b/_autosummary/poli.core.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox.html b/_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox.html index 3455fba1..97af8278 100644 --- a/_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox.html +++ b/_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.multi_objective_black_box.html b/_autosummary/poli.core.multi_objective_black_box.html index 388066f9..42da786e 100644 --- a/_autosummary/poli.core.multi_objective_black_box.html +++ b/_autosummary/poli.core.multi_objective_black_box.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.problem.html b/_autosummary/poli.core.problem.html index 0bf774e7..ce59beed 100644 --- a/_autosummary/poli.core.problem.html +++ b/_autosummary/poli.core.problem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.problem_setup_information.ProblemSetupInformation.html b/_autosummary/poli.core.problem_setup_information.ProblemSetupInformation.html index 6d2396fc..b8b02ec8 100644 --- a/_autosummary/poli.core.problem_setup_information.ProblemSetupInformation.html +++ b/_autosummary/poli.core.problem_setup_information.ProblemSetupInformation.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.problem_setup_information.html b/_autosummary/poli.core.problem_setup_information.html index 6de2edeb..b708c6ef 100644 --- a/_autosummary/poli.core.problem_setup_information.html +++ b/_autosummary/poli.core.problem_setup_information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox.html b/_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox.html index 095fac0f..f3561c0c 100644 --- a/_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox.html +++ b/_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.proteins.foldx_black_box.html b/_autosummary/poli.core.proteins.foldx_black_box.html index ab99d7d1..e3c4942c 100644 --- a/_autosummary/poli.core.proteins.foldx_black_box.html +++ b/_autosummary/poli.core.proteins.foldx_black_box.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.proteins.foldx_isolated_function.html b/_autosummary/poli.core.proteins.foldx_isolated_function.html index 75fcfae1..80569f4f 100644 --- a/_autosummary/poli.core.proteins.foldx_isolated_function.html +++ b/_autosummary/poli.core.proteins.foldx_isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.proteins.html b/_autosummary/poli.core.proteins.html index 4231fb52..6dee0635 100644 --- a/_autosummary/poli.core.proteins.html +++ b/_autosummary/poli.core.proteins.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.delete_observer_run_script.html b/_autosummary/poli.core.registry.delete_observer_run_script.html index 1f4212cc..4443248d 100644 --- a/_autosummary/poli.core.registry.delete_observer_run_script.html +++ b/_autosummary/poli.core.registry.delete_observer_run_script.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.delete_problem.html b/_autosummary/poli.core.registry.delete_problem.html index 539499ee..920d597a 100644 --- a/_autosummary/poli.core.registry.delete_problem.html +++ b/_autosummary/poli.core.registry.delete_problem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.get_problem_factories.html b/_autosummary/poli.core.registry.get_problem_factories.html index 99fb236a..26d305f3 100644 --- a/_autosummary/poli.core.registry.get_problem_factories.html +++ b/_autosummary/poli.core.registry.get_problem_factories.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.get_problems.html b/_autosummary/poli.core.registry.get_problems.html index 67bb53ad..4143ca4f 100644 --- a/_autosummary/poli.core.registry.get_problems.html +++ b/_autosummary/poli.core.registry.get_problems.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.html b/_autosummary/poli.core.registry.html index 4594ac50..7f26ae0f 100644 --- a/_autosummary/poli.core.registry.html +++ b/_autosummary/poli.core.registry.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.register_problem.html b/_autosummary/poli.core.registry.register_problem.html index 0f5411ce..62b494ce 100644 --- a/_autosummary/poli.core.registry.register_problem.html +++ b/_autosummary/poli.core.registry.register_problem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.register_problem_from_repository.html b/_autosummary/poli.core.registry.register_problem_from_repository.html index 3ac95a15..5685be63 100644 --- a/_autosummary/poli.core.registry.register_problem_from_repository.html +++ b/_autosummary/poli.core.registry.register_problem_from_repository.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.set_observer.html b/_autosummary/poli.core.registry.set_observer.html index 0b394be4..fc6c9456 100644 --- a/_autosummary/poli.core.registry.set_observer.html +++ b/_autosummary/poli.core.registry.set_observer.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.registry.set_observer_run_script.html b/_autosummary/poli.core.registry.set_observer_run_script.html index 54543140..c516bdf4 100644 --- a/_autosummary/poli.core.registry.set_observer_run_script.html +++ b/_autosummary/poli.core.registry.set_observer_run_script.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.abstract_observer.AbstractObserver.html b/_autosummary/poli.core.util.abstract_observer.AbstractObserver.html index 953ccd1f..70471114 100644 --- a/_autosummary/poli.core.util.abstract_observer.AbstractObserver.html +++ b/_autosummary/poli.core.util.abstract_observer.AbstractObserver.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.abstract_observer.html b/_autosummary/poli.core.util.abstract_observer.html index 7e6204d7..6d233e43 100644 --- a/_autosummary/poli.core.util.abstract_observer.html +++ b/_autosummary/poli.core.util.abstract_observer.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.algorithm_observer_wrapper.html b/_autosummary/poli.core.util.algorithm_observer_wrapper.html index e7cc366e..c230a5b4 100644 --- a/_autosummary/poli.core.util.algorithm_observer_wrapper.html +++ b/_autosummary/poli.core.util.algorithm_observer_wrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.alignment.html b/_autosummary/poli.core.util.alignment.html index 71641448..b0722b32 100644 --- a/_autosummary/poli.core.util.alignment.html +++ b/_autosummary/poli.core.util.alignment.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.alignment.is_aligned.html b/_autosummary/poli.core.util.alignment.is_aligned.html index 717152da..2892b6b4 100644 --- a/_autosummary/poli.core.util.alignment.is_aligned.html +++ b/_autosummary/poli.core.util.alignment.is_aligned.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.batch.batch_input.batched.html b/_autosummary/poli.core.util.batch.batch_input.batched.html index df5d3177..5a6c2430 100644 --- a/_autosummary/poli.core.util.batch.batch_input.batched.html +++ b/_autosummary/poli.core.util.batch.batch_input.batched.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.batch.batch_input.html b/_autosummary/poli.core.util.batch.batch_input.html index 03b825a1..3a94cc25 100644 --- a/_autosummary/poli.core.util.batch.batch_input.html +++ b/_autosummary/poli.core.util.batch.batch_input.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.batch.html b/_autosummary/poli.core.util.batch.html index 46073cc6..e76dfed1 100644 --- a/_autosummary/poli.core.util.batch.html +++ b/_autosummary/poli.core.util.batch.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.html b/_autosummary/poli.core.util.chemistry.html index a450c394..264464ad 100644 --- a/_autosummary/poli.core.util.chemistry.html +++ b/_autosummary/poli.core.util.chemistry.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.string_to_molecule.html b/_autosummary/poli.core.util.chemistry.string_to_molecule.html index f052c7a2..fb4dec64 100644 --- a/_autosummary/poli.core.util.chemistry.string_to_molecule.html +++ b/_autosummary/poli.core.util.chemistry.string_to_molecule.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules.html b/_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules.html index 678080e1..8378375b 100644 --- a/_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules.html +++ b/_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules.html b/_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules.html index 37428975..b341f5f0 100644 --- a/_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules.html +++ b/_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules.html b/_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules.html index 47928010..2be7893d 100644 --- a/_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules.html +++ b/_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles.html b/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles.html index 0ca8e8ae..2a74e030 100644 --- a/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles.html +++ b/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies.html b/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies.html index bfb721d4..a370cb09 100644 --- a/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies.html +++ b/_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.default_observer.html b/_autosummary/poli.core.util.default_observer.html index c6a8401e..0d8c6c91 100644 --- a/_autosummary/poli.core.util.default_observer.html +++ b/_autosummary/poli.core.util.default_observer.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.external_observer.ExternalObserver.html b/_autosummary/poli.core.util.external_observer.ExternalObserver.html index 888c5b8e..ddd2a69e 100644 --- a/_autosummary/poli.core.util.external_observer.ExternalObserver.html +++ b/_autosummary/poli.core.util.external_observer.ExternalObserver.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.external_observer.html b/_autosummary/poli.core.util.external_observer.html index ad4ddb47..43b4213d 100644 --- a/_autosummary/poli.core.util.external_observer.html +++ b/_autosummary/poli.core.util.external_observer.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository.html b/_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository.html index 27a66e98..51cfbdf7 100644 --- a/_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository.html +++ b/_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag.html b/_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag.html index 91d4cac3..a9f5f841 100644 --- a/_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag.html +++ b/_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.files.download_files_from_github.html b/_autosummary/poli.core.util.files.download_files_from_github.html index d818ba5f..2f6ec494 100644 --- a/_autosummary/poli.core.util.files.download_files_from_github.html +++ b/_autosummary/poli.core.util.files.download_files_from_github.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.files.html b/_autosummary/poli.core.util.files.html index 889ecaee..b2a8d24e 100644 --- a/_autosummary/poli.core.util.files.html +++ b/_autosummary/poli.core.util.files.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath.html b/_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath.html index f28059ac..6e2a7ef0 100644 --- a/_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath.html +++ b/_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.files.integrity.html b/_autosummary/poli.core.util.files.integrity.html index d2cd8054..f2ac9986 100644 --- a/_autosummary/poli.core.util.files.integrity.html +++ b/_autosummary/poli.core.util.files.integrity.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.html b/_autosummary/poli.core.util.html index c3652109..d37c0f62 100644 --- a/_autosummary/poli.core.util.html +++ b/_autosummary/poli.core.util.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.inter_process_communication.html b/_autosummary/poli.core.util.inter_process_communication.html index bbf45f42..832c8552 100644 --- a/_autosummary/poli.core.util.inter_process_communication.html +++ b/_autosummary/poli.core.util.inter_process_communication.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper.html b/_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper.html index ceeb8148..012a2712 100644 --- a/_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper.html +++ b/_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection.html b/_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection.html index ff2f2610..69cb675d 100644 --- a/_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection.html +++ b/_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.inter_process_communication.process_wrapper.html b/_autosummary/poli.core.util.inter_process_communication.process_wrapper.html index 8df5c729..775fe3bf 100644 --- a/_autosummary/poli.core.util.inter_process_communication.process_wrapper.html +++ b/_autosummary/poli.core.util.inter_process_communication.process_wrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.isolation.external_black_box.html b/_autosummary/poli.core.util.isolation.external_black_box.html index 50acd6b7..d3f1f1fc 100644 --- a/_autosummary/poli.core.util.isolation.external_black_box.html +++ b/_autosummary/poli.core.util.isolation.external_black_box.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.isolation.external_function.html b/_autosummary/poli.core.util.isolation.external_function.html index a3fa6423..306da4b6 100644 --- a/_autosummary/poli.core.util.isolation.external_function.html +++ b/_autosummary/poli.core.util.isolation.external_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.isolation.html b/_autosummary/poli.core.util.isolation.html index 5d50cb02..d572e8ec 100644 --- a/_autosummary/poli.core.util.isolation.html +++ b/_autosummary/poli.core.util.isolation.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.isolation.instancing.html b/_autosummary/poli.core.util.isolation.instancing.html index f4fe4f96..e939ca95 100644 --- a/_autosummary/poli.core.util.isolation.instancing.html +++ b/_autosummary/poli.core.util.isolation.instancing.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.isolation.isolated_black_box.html b/_autosummary/poli.core.util.isolation.isolated_black_box.html index f94c5426..31903541 100644 --- a/_autosummary/poli.core.util.isolation.isolated_black_box.html +++ b/_autosummary/poli.core.util.isolation.isolated_black_box.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.multi_observer.html b/_autosummary/poli.core.util.multi_observer.html index fd7beb6b..6e684526 100644 --- a/_autosummary/poli.core.util.multi_observer.html +++ b/_autosummary/poli.core.util.multi_observer.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.objective_management.html b/_autosummary/poli.core.util.objective_management.html index 40e9b1fb..1a9e4f17 100644 --- a/_autosummary/poli.core.util.objective_management.html +++ b/_autosummary/poli.core.util.objective_management.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.objective_management.make_run_script.html b/_autosummary/poli.core.util.objective_management.make_run_script.html index d37d6137..82b14e39 100644 --- a/_autosummary/poli.core.util.objective_management.make_run_script.html +++ b/_autosummary/poli.core.util.objective_management.make_run_script.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script.html b/_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script.html index c9cfb4be..f621c7e6 100644 --- a/_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script.html +++ b/_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.objective_management.make_run_script.make_run_script.html b/_autosummary/poli.core.util.objective_management.make_run_script.make_run_script.html index d06f1c8c..c309a20c 100644 --- a/_autosummary/poli.core.util.objective_management.make_run_script.make_run_script.html +++ b/_autosummary/poli.core.util.objective_management.make_run_script.make_run_script.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.observer_wrapper.html b/_autosummary/poli.core.util.observer_wrapper.html index 4bad4cd9..af5e5c9d 100644 --- a/_autosummary/poli.core.util.observer_wrapper.html +++ b/_autosummary/poli.core.util.observer_wrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.observer_wrapper.start_observer_process.html b/_autosummary/poli.core.util.observer_wrapper.start_observer_process.html index 80094f95..66145cb5 100644 --- a/_autosummary/poli.core.util.observer_wrapper.start_observer_process.html +++ b/_autosummary/poli.core.util.observer_wrapper.start_observer_process.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.defaults.html b/_autosummary/poli.core.util.proteins.defaults.html index ea1faee2..b47d7839 100644 --- a/_autosummary/poli.core.util.proteins.defaults.html +++ b/_autosummary/poli.core.util.proteins.defaults.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.foldx.FoldxInterface.html b/_autosummary/poli.core.util.proteins.foldx.FoldxInterface.html index 36d90e45..76ad7802 100644 --- a/_autosummary/poli.core.util.proteins.foldx.FoldxInterface.html +++ b/_autosummary/poli.core.util.proteins.foldx.FoldxInterface.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.foldx.html b/_autosummary/poli.core.util.proteins.foldx.html index e41aeda5..fefbdd99 100644 --- a/_autosummary/poli.core.util.proteins.foldx.html +++ b/_autosummary/poli.core.util.proteins.foldx.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.html b/_autosummary/poli.core.util.proteins.html index af0d6bb8..ed81ec16 100644 --- a/_autosummary/poli.core.util.proteins.html +++ b/_autosummary/poli.core.util.proteins.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.mutations.edits_between_strings.html b/_autosummary/poli.core.util.proteins.mutations.edits_between_strings.html index 1e9cb59c..231fc297 100644 --- a/_autosummary/poli.core.util.proteins.mutations.edits_between_strings.html +++ b/_autosummary/poli.core.util.proteins.mutations.edits_between_strings.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant.html b/_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant.html index e7c31bf5..a72bc740 100644 --- a/_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant.html +++ b/_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.mutations.html b/_autosummary/poli.core.util.proteins.mutations.html index 8a91cba9..db285142 100644 --- a/_autosummary/poli.core.util.proteins.mutations.html +++ b/_autosummary/poli.core.util.proteins.mutations.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant.html b/_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant.html index 1e544ecf..5185df5d 100644 --- a/_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant.html +++ b/_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.pdb_parsing.html b/_autosummary/poli.core.util.proteins.pdb_parsing.html index ecba2758..cab947cb 100644 --- a/_autosummary/poli.core.util.proteins.pdb_parsing.html +++ b/_autosummary/poli.core.util.proteins.pdb_parsing.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings.html b/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings.html index 9ec9ab18..06416421 100644 --- a/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings.html +++ b/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues.html b/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues.html index d99e13ad..46253024 100644 --- a/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues.html +++ b/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure.html b/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure.html index 1cfd0459..3591aed8 100644 --- a/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure.html +++ b/_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.html b/_autosummary/poli.core.util.proteins.rasp.html index 84da99b1..7df889e1 100644 --- a/_autosummary/poli.core.util.proteins.rasp.html +++ b/_autosummary/poli.core.util.proteins.rasp.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData.html b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData.html index 1440b8ce..1b1988ba 100644 --- a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData.html +++ b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model.html b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model.html index 5015588c..c4fe7c0c 100644 --- a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model.html +++ b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers.html b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers.html index 500e44c8..4863269c 100644 --- a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers.html +++ b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.html b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.html index 27de3969..488932e6 100644 --- a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.html +++ b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline.html b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline.html index 29f38c70..70d98a14 100644 --- a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline.html +++ b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization.html b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization.html index 01b2f9f6..63566093 100644 --- a/_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization.html +++ b/_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.load_models.html b/_autosummary/poli.core.util.proteins.rasp.load_models.html index 21ad1d21..512671ad 100644 --- a/_autosummary/poli.core.util.proteins.rasp.load_models.html +++ b/_autosummary/poli.core.util.proteins.rasp.load_models.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.proteins.rasp.rasp_interface.html b/_autosummary/poli.core.util.proteins.rasp.rasp_interface.html index bf130d15..3afdca6a 100644 --- a/_autosummary/poli.core.util.proteins.rasp.rasp_interface.html +++ b/_autosummary/poli.core.util.proteins.rasp.rasp_interface.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.seeding.html b/_autosummary/poli.core.util.seeding.html index d487dffb..4eb4fd91 100644 --- a/_autosummary/poli.core.util.seeding.html +++ b/_autosummary/poli.core.util.seeding.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.seeding.seeding.html b/_autosummary/poli.core.util.seeding.seeding.html index 4d83322f..094c8e41 100644 --- a/_autosummary/poli.core.util.seeding.seeding.html +++ b/_autosummary/poli.core.util.seeding.seeding.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.seeding.seeding.seed_numpy.html b/_autosummary/poli.core.util.seeding.seeding.seed_numpy.html index 564801ee..5bee4ff7 100644 --- a/_autosummary/poli.core.util.seeding.seeding.seed_numpy.html +++ b/_autosummary/poli.core.util.seeding.seeding.seed_numpy.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.core.util.seeding.seeding.seed_python.html b/_autosummary/poli.core.util.seeding.seeding.seed_python.html index 2a5b6286..02bbbda6 100644 --- a/_autosummary/poli.core.util.seeding.seeding.seed_python.html +++ b/_autosummary/poli.core.util.seeding.seeding.seed_python.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.html b/_autosummary/poli.html index 949c05d8..eb4269e6 100644 --- a/_autosummary/poli.html +++ b/_autosummary/poli.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective.dynamically_instantiate.html b/_autosummary/poli.objective.dynamically_instantiate.html index 5c3021e0..4e93caf4 100644 --- a/_autosummary/poli.objective.dynamically_instantiate.html +++ b/_autosummary/poli.objective.dynamically_instantiate.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective.html b/_autosummary/poli.objective.html index f3fc8929..98f79ad4 100644 --- a/_autosummary/poli.objective.html +++ b/_autosummary/poli.objective.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective.parse_factory_kwargs.html b/_autosummary/poli.objective.parse_factory_kwargs.html index cfe51777..10df5db7 100644 --- a/_autosummary/poli.objective.parse_factory_kwargs.html +++ b/_autosummary/poli.objective.parse_factory_kwargs.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective.run.html b/_autosummary/poli.objective.run.html index 5a78a6e1..e8eccac3 100644 --- a/_autosummary/poli.objective.run.html +++ b/_autosummary/poli.objective.run.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_factory.ExternalBlackBox.html b/_autosummary/poli.objective_factory.ExternalBlackBox.html index 19dd93ec..8ec85416 100644 --- a/_autosummary/poli.objective_factory.ExternalBlackBox.html +++ b/_autosummary/poli.objective_factory.ExternalBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_factory.create.html b/_autosummary/poli.objective_factory.create.html index faf44a85..b2287fd4 100644 --- a/_autosummary/poli.objective_factory.create.html +++ b/_autosummary/poli.objective_factory.create.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_factory.html b/_autosummary/poli.objective_factory.html index da50c5d8..22dcfd4b 100644 --- a/_autosummary/poli.objective_factory.html +++ b/_autosummary/poli.objective_factory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_factory.load_config.html b/_autosummary/poli.objective_factory.load_config.html index f5bb76b7..daa6b4d6 100644 --- a/_autosummary/poli.objective_factory.load_config.html +++ b/_autosummary/poli.objective_factory.load_config.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_factory.start.html b/_autosummary/poli.objective_factory.start.html index bfbc629e..d67039d0 100644 --- a/_autosummary/poli.objective_factory.start.html +++ b/_autosummary/poli.objective_factory.start.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.albuterol_similarity.html b/_autosummary/poli.objective_repository.albuterol_similarity.html index e13e9962..6749ca56 100644 --- a/_autosummary/poli.objective_repository.albuterol_similarity.html +++ b/_autosummary/poli.objective_repository.albuterol_similarity.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.albuterol_similarity.information.html b/_autosummary/poli.objective_repository.albuterol_similarity.information.html index deca0d47..e378d039 100644 --- a/_autosummary/poli.objective_repository.albuterol_similarity.information.html +++ b/_autosummary/poli.objective_repository.albuterol_similarity.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.albuterol_similarity.register.html b/_autosummary/poli.objective_repository.albuterol_similarity.register.html index 98df5a42..79942fdd 100644 --- a/_autosummary/poli.objective_repository.albuterol_similarity.register.html +++ b/_autosummary/poli.objective_repository.albuterol_similarity.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.aloha.html b/_autosummary/poli.objective_repository.aloha.html index 379ba30b..f66296e0 100644 --- a/_autosummary/poli.objective_repository.aloha.html +++ b/_autosummary/poli.objective_repository.aloha.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox.html b/_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox.html index 2a79b76b..74739d56 100644 --- a/_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox.html +++ b/_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory.html b/_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory.html index 86fef9ac..feece506 100644 --- a/_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory.html +++ b/_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.aloha.register.html b/_autosummary/poli.objective_repository.aloha.register.html index b659f6df..4ccc9329 100644 --- a/_autosummary/poli.objective_repository.aloha.register.html +++ b/_autosummary/poli.objective_repository.aloha.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.amlodipine_mpo.html b/_autosummary/poli.objective_repository.amlodipine_mpo.html index 0960fd7a..cbc1f119 100644 --- a/_autosummary/poli.objective_repository.amlodipine_mpo.html +++ b/_autosummary/poli.objective_repository.amlodipine_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.amlodipine_mpo.information.html b/_autosummary/poli.objective_repository.amlodipine_mpo.information.html index 6f6d7af4..40db0fa3 100644 --- a/_autosummary/poli.objective_repository.amlodipine_mpo.information.html +++ b/_autosummary/poli.objective_repository.amlodipine_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.amlodipine_mpo.register.html b/_autosummary/poli.objective_repository.amlodipine_mpo.register.html index 5e68c980..954d053e 100644 --- a/_autosummary/poli.objective_repository.amlodipine_mpo.register.html +++ b/_autosummary/poli.objective_repository.amlodipine_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.celecoxib_rediscovery.html b/_autosummary/poli.objective_repository.celecoxib_rediscovery.html index d4cda9e4..f6d4bf15 100644 --- a/_autosummary/poli.objective_repository.celecoxib_rediscovery.html +++ b/_autosummary/poli.objective_repository.celecoxib_rediscovery.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.celecoxib_rediscovery.information.html b/_autosummary/poli.objective_repository.celecoxib_rediscovery.information.html index 86f16b33..e15e9fbd 100644 --- a/_autosummary/poli.objective_repository.celecoxib_rediscovery.information.html +++ b/_autosummary/poli.objective_repository.celecoxib_rediscovery.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.celecoxib_rediscovery.register.html b/_autosummary/poli.objective_repository.celecoxib_rediscovery.register.html index 3c7f6637..d30aba0b 100644 --- a/_autosummary/poli.objective_repository.celecoxib_rediscovery.register.html +++ b/_autosummary/poli.objective_repository.celecoxib_rediscovery.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.deco_hop.html b/_autosummary/poli.objective_repository.deco_hop.html index 0467e7ba..91b042ab 100644 --- a/_autosummary/poli.objective_repository.deco_hop.html +++ b/_autosummary/poli.objective_repository.deco_hop.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.deco_hop.information.html b/_autosummary/poli.objective_repository.deco_hop.information.html index 75ad65fd..5f75c947 100644 --- a/_autosummary/poli.objective_repository.deco_hop.information.html +++ b/_autosummary/poli.objective_repository.deco_hop.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.deco_hop.register.html b/_autosummary/poli.objective_repository.deco_hop.register.html index 50fd9019..6bde7c78 100644 --- a/_autosummary/poli.objective_repository.deco_hop.register.html +++ b/_autosummary/poli.objective_repository.deco_hop.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.dockstring.html b/_autosummary/poli.objective_repository.dockstring.html index 56b5117a..e966d9df 100644 --- a/_autosummary/poli.objective_repository.dockstring.html +++ b/_autosummary/poli.objective_repository.dockstring.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.dockstring.information.html b/_autosummary/poli.objective_repository.dockstring.information.html index e570bbcb..7880c922 100644 --- a/_autosummary/poli.objective_repository.dockstring.information.html +++ b/_autosummary/poli.objective_repository.dockstring.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.dockstring.isolated_function.html b/_autosummary/poli.objective_repository.dockstring.isolated_function.html index b17e907f..c96af4fe 100644 --- a/_autosummary/poli.objective_repository.dockstring.isolated_function.html +++ b/_autosummary/poli.objective_repository.dockstring.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox.html b/_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox.html index 64773db0..149eccba 100644 --- a/_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox.html +++ b/_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory.html b/_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory.html index 0ba3043e..b0dcf900 100644 --- a/_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory.html +++ b/_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.dockstring.register.html b/_autosummary/poli.objective_repository.dockstring.register.html index 7a9288dd..9e4bd770 100644 --- a/_autosummary/poli.objective_repository.dockstring.register.html +++ b/_autosummary/poli.objective_repository.dockstring.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd2_docking.html b/_autosummary/poli.objective_repository.drd2_docking.html index 8f3878b2..a2a25b06 100644 --- a/_autosummary/poli.objective_repository.drd2_docking.html +++ b/_autosummary/poli.objective_repository.drd2_docking.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd2_docking.information.html b/_autosummary/poli.objective_repository.drd2_docking.information.html index ba3b1c6b..11a2905a 100644 --- a/_autosummary/poli.objective_repository.drd2_docking.information.html +++ b/_autosummary/poli.objective_repository.drd2_docking.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd2_docking.register.html b/_autosummary/poli.objective_repository.drd2_docking.register.html index 95c43145..7e81761b 100644 --- a/_autosummary/poli.objective_repository.drd2_docking.register.html +++ b/_autosummary/poli.objective_repository.drd2_docking.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd3_docking.html b/_autosummary/poli.objective_repository.drd3_docking.html index 1ab1dbc1..18e6a17c 100644 --- a/_autosummary/poli.objective_repository.drd3_docking.html +++ b/_autosummary/poli.objective_repository.drd3_docking.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd3_docking.information.html b/_autosummary/poli.objective_repository.drd3_docking.information.html index e7afffc3..56ee563a 100644 --- a/_autosummary/poli.objective_repository.drd3_docking.information.html +++ b/_autosummary/poli.objective_repository.drd3_docking.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd3_docking.isolated_function.html b/_autosummary/poli.objective_repository.drd3_docking.isolated_function.html index 4c8dcd39..3a2cb793 100644 --- a/_autosummary/poli.objective_repository.drd3_docking.isolated_function.html +++ b/_autosummary/poli.objective_repository.drd3_docking.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox.html b/_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox.html index 383a0662..26ddc430 100644 --- a/_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox.html +++ b/_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory.html b/_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory.html index 8679fb73..d8d31a2b 100644 --- a/_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory.html +++ b/_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.drd3_docking.register.html b/_autosummary/poli.objective_repository.drd3_docking.register.html index 1b21d918..4bf35956 100644 --- a/_autosummary/poli.objective_repository.drd3_docking.register.html +++ b/_autosummary/poli.objective_repository.drd3_docking.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.ehrlich.html b/_autosummary/poli.objective_repository.ehrlich.html index bf1450fb..35c78703 100644 --- a/_autosummary/poli.objective_repository.ehrlich.html +++ b/_autosummary/poli.objective_repository.ehrlich.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.ehrlich.information.html b/_autosummary/poli.objective_repository.ehrlich.information.html index 318ae086..13266701 100644 --- a/_autosummary/poli.objective_repository.ehrlich.information.html +++ b/_autosummary/poli.objective_repository.ehrlich.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.ehrlich.register.html b/_autosummary/poli.objective_repository.ehrlich.register.html index df637550..ee0cdd9c 100644 --- a/_autosummary/poli.objective_repository.ehrlich.register.html +++ b/_autosummary/poli.objective_repository.ehrlich.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.fexofenadine_mpo.html b/_autosummary/poli.objective_repository.fexofenadine_mpo.html index 0a13e095..1364a2c7 100644 --- a/_autosummary/poli.objective_repository.fexofenadine_mpo.html +++ b/_autosummary/poli.objective_repository.fexofenadine_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.fexofenadine_mpo.information.html b/_autosummary/poli.objective_repository.fexofenadine_mpo.information.html index f5cc3f73..75ef7714 100644 --- a/_autosummary/poli.objective_repository.fexofenadine_mpo.information.html +++ b/_autosummary/poli.objective_repository.fexofenadine_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.fexofenadine_mpo.register.html b/_autosummary/poli.objective_repository.fexofenadine_mpo.register.html index 762b4e80..e301a1dd 100644 --- a/_autosummary/poli.objective_repository.fexofenadine_mpo.register.html +++ b/_autosummary/poli.objective_repository.fexofenadine_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.html index 21a983c3..82b384eb 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.information.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.information.html index 44e3413a..969e50bb 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.information.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function.html index 65c975d6..863fbd57 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config.html index ca9ab051..e205ad46 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper.html index 7de85c9f..d647d9a9 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory.html index ce71b4c2..3ca14d39 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config.html index 66c66d18..c6e94c53 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.html b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.html index d957d19a..6ebbbb35 100644 --- a/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.html +++ b/_autosummary/poli.objective_repository.foldx_rfp_lambo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.foldx_utils.html b/_autosummary/poli.objective_repository.foldx_sasa.foldx_utils.html index 21923246..5dc4fce1 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.foldx_utils.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.foldx_utils.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.html b/_autosummary/poli.objective_repository.foldx_sasa.html index 43fc69b3..d84c4b4b 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.information.html b/_autosummary/poli.objective_repository.foldx_sasa.information.html index 187da48b..09086cad 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.information.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.isolated_function.html b/_autosummary/poli.objective_repository.foldx_sasa.isolated_function.html index 812f5c2e..46aaea26 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.isolated_function.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox.html b/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox.html index a7d4b6bc..8cfac1d8 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory.html b/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory.html index 2d5ae274..7b55dc79 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_sasa.register.html b/_autosummary/poli.objective_repository.foldx_sasa.register.html index eaa57478..a7674765 100644 --- a/_autosummary/poli.objective_repository.foldx_sasa.register.html +++ b/_autosummary/poli.objective_repository.foldx_sasa.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.foldx_utils.html b/_autosummary/poli.objective_repository.foldx_stability.foldx_utils.html index 4ccd5b03..26521517 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.foldx_utils.html +++ b/_autosummary/poli.objective_repository.foldx_stability.foldx_utils.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.html b/_autosummary/poli.objective_repository.foldx_stability.html index 0e2ac358..8d8144fc 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.html +++ b/_autosummary/poli.objective_repository.foldx_stability.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.information.html b/_autosummary/poli.objective_repository.foldx_stability.information.html index cffbc6d2..47685b67 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.information.html +++ b/_autosummary/poli.objective_repository.foldx_stability.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.isolated_function.html b/_autosummary/poli.objective_repository.foldx_stability.isolated_function.html index df476ac9..c62d928e 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.isolated_function.html +++ b/_autosummary/poli.objective_repository.foldx_stability.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox.html b/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox.html index 61ea4b8e..96d50799 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox.html +++ b/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory.html b/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory.html index 18036167..616624f9 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory.html +++ b/_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability.register.html b/_autosummary/poli.objective_repository.foldx_stability.register.html index 67e2497f..cdfc7b6a 100644 --- a/_autosummary/poli.objective_repository.foldx_stability.register.html +++ b/_autosummary/poli.objective_repository.foldx_stability.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.html b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.html index 71811999..8cf247d2 100644 --- a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.html +++ b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.information.html b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.information.html index 4b1468c0..4b62aee0 100644 --- a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.information.html +++ b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function.html b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function.html index df000cdf..fa940e45 100644 --- a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function.html +++ b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox.html b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox.html index 0058696f..0f81b7bf 100644 --- a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox.html +++ b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory.html b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory.html index 1bf81430..25517e75 100644 --- a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory.html +++ b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.html b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.html index 48460c60..97d3dfec 100644 --- a/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.html +++ b/_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper.html b/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper.html index 5cd79d28..61c05b83 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.html b/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.html index 1b082973..25ed4b65 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array.html index 05783b51..9fa4e37f 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas.html index 7268de7b..99b44a4c 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence.html index 1a52f490..2716c67d 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax.html index a76bb94d..dab66f58 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions.html index 072a7f10..93facb81 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y.html index 928cfe71..b59b9674 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa.html index 6696eeaf..91c3f599 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq.html index 583caa48..b9e2aa18 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples.html index a036e44a..9e3ddd5d 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.html index 19b837f0..6bde2880 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa.html index bdece04d..8cb130d4 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array.html index 3c18b4c5..a98748a4 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna.html index ef4d9621..d4f1d2fa 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data.html index 3178ee1c..2b06e914 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data.html index 123c443f..8064ca1e 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper.html index 0058daa6..78c1943d 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder.html index 560fee5d..668db047 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder.html index 71d5d576..b88b1bb8 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.html b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.html index 1122d1d5..79995fbc 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.gfp_gp.html b/_autosummary/poli.objective_repository.gfp_cbas.gfp_gp.html index 7f147aa2..c19c5bdb 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.gfp_gp.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.gfp_gp.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.html b/_autosummary/poli.objective_repository.gfp_cbas.html index 28795d96..46c2cc50 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.information.html b/_autosummary/poli.objective_repository.gfp_cbas.information.html index 03c02bcb..cde1ed99 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.information.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.isolated_function.html b/_autosummary/poli.objective_repository.gfp_cbas.isolated_function.html index 76c4ad8d..67ba69d1 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.isolated_function.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE.html b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE.html index 92f05459..b11455fa 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE.html b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE.html index 20073a45..04961551 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae.html b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae.html index f225e095..93db7244 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.html b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.html index 08e60f51..1ac577b4 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss.html b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss.html index 2cfc30f8..e0488f10 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy.html b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy.html index b910d109..04538106 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox.html b/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox.html index 338f5fea..e3577e1a 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory.html b/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory.html index 23d00520..077fe542 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_cbas.register.html b/_autosummary/poli.objective_repository.gfp_cbas.register.html index 8c22534e..7286a623 100644 --- a/_autosummary/poli.objective_repository.gfp_cbas.register.html +++ b/_autosummary/poli.objective_repository.gfp_cbas.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_select.html b/_autosummary/poli.objective_repository.gfp_select.html index 90d69e29..1be4a9e2 100644 --- a/_autosummary/poli.objective_repository.gfp_select.html +++ b/_autosummary/poli.objective_repository.gfp_select.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_select.information.html b/_autosummary/poli.objective_repository.gfp_select.information.html index 49bfd492..9e34b225 100644 --- a/_autosummary/poli.objective_repository.gfp_select.information.html +++ b/_autosummary/poli.objective_repository.gfp_select.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_select.isolated_function.html b/_autosummary/poli.objective_repository.gfp_select.isolated_function.html index f68bc3e6..753f6a21 100644 --- a/_autosummary/poli.objective_repository.gfp_select.isolated_function.html +++ b/_autosummary/poli.objective_repository.gfp_select.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox.html b/_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox.html index 799918d3..76bcaa1f 100644 --- a/_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox.html +++ b/_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory.html b/_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory.html index 9756f0b4..301efc6d 100644 --- a/_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory.html +++ b/_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gfp_select.register.html b/_autosummary/poli.objective_repository.gfp_select.register.html index ccc8ed35..9fba07d1 100644 --- a/_autosummary/poli.objective_repository.gfp_select.register.html +++ b/_autosummary/poli.objective_repository.gfp_select.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gsk3_beta.html b/_autosummary/poli.objective_repository.gsk3_beta.html index 50ca9412..4ca35432 100644 --- a/_autosummary/poli.objective_repository.gsk3_beta.html +++ b/_autosummary/poli.objective_repository.gsk3_beta.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gsk3_beta.information.html b/_autosummary/poli.objective_repository.gsk3_beta.information.html index 4eb82646..6ea7217f 100644 --- a/_autosummary/poli.objective_repository.gsk3_beta.information.html +++ b/_autosummary/poli.objective_repository.gsk3_beta.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.gsk3_beta.register.html b/_autosummary/poli.objective_repository.gsk3_beta.register.html index 0e78cef9..ac3eaae6 100644 --- a/_autosummary/poli.objective_repository.gsk3_beta.register.html +++ b/_autosummary/poli.objective_repository.gsk3_beta.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.html b/_autosummary/poli.objective_repository.html index 560b9bff..059f1743 100644 --- a/_autosummary/poli.objective_repository.html +++ b/_autosummary/poli.objective_repository.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.isomer_c7h8n2o2.html b/_autosummary/poli.objective_repository.isomer_c7h8n2o2.html index c006fe0c..f491999a 100644 --- a/_autosummary/poli.objective_repository.isomer_c7h8n2o2.html +++ b/_autosummary/poli.objective_repository.isomer_c7h8n2o2.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.isomer_c7h8n2o2.information.html b/_autosummary/poli.objective_repository.isomer_c7h8n2o2.information.html index b14fd508..fc2f5730 100644 --- a/_autosummary/poli.objective_repository.isomer_c7h8n2o2.information.html +++ b/_autosummary/poli.objective_repository.isomer_c7h8n2o2.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.isomer_c7h8n2o2.register.html b/_autosummary/poli.objective_repository.isomer_c7h8n2o2.register.html index 4f5538d6..ef1a489d 100644 --- a/_autosummary/poli.objective_repository.isomer_c7h8n2o2.register.html +++ b/_autosummary/poli.objective_repository.isomer_c7h8n2o2.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.html b/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.html index 8979558f..1ba7e94b 100644 --- a/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.html +++ b/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information.html b/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information.html index 27fbd97f..200d5a3d 100644 --- a/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information.html +++ b/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register.html b/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register.html index 3b91ac36..1a9faede 100644 --- a/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register.html +++ b/_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.jnk3.html b/_autosummary/poli.objective_repository.jnk3.html index 8377f921..31445ece 100644 --- a/_autosummary/poli.objective_repository.jnk3.html +++ b/_autosummary/poli.objective_repository.jnk3.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.jnk3.information.html b/_autosummary/poli.objective_repository.jnk3.information.html index b9a4c5a7..b91a6bec 100644 --- a/_autosummary/poli.objective_repository.jnk3.information.html +++ b/_autosummary/poli.objective_repository.jnk3.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.jnk3.register.html b/_autosummary/poli.objective_repository.jnk3.register.html index ea8a9c28..e9649dac 100644 --- a/_autosummary/poli.objective_repository.jnk3.register.html +++ b/_autosummary/poli.objective_repository.jnk3.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.median_1.html b/_autosummary/poli.objective_repository.median_1.html index c1c7bc25..1f9f9fdf 100644 --- a/_autosummary/poli.objective_repository.median_1.html +++ b/_autosummary/poli.objective_repository.median_1.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.median_1.information.html b/_autosummary/poli.objective_repository.median_1.information.html index c909e362..bfa13ea4 100644 --- a/_autosummary/poli.objective_repository.median_1.information.html +++ b/_autosummary/poli.objective_repository.median_1.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.median_1.register.html b/_autosummary/poli.objective_repository.median_1.register.html index 7a3b6392..74dc399e 100644 --- a/_autosummary/poli.objective_repository.median_1.register.html +++ b/_autosummary/poli.objective_repository.median_1.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.median_2.html b/_autosummary/poli.objective_repository.median_2.html index 6757277d..352ce877 100644 --- a/_autosummary/poli.objective_repository.median_2.html +++ b/_autosummary/poli.objective_repository.median_2.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.median_2.information.html b/_autosummary/poli.objective_repository.median_2.information.html index ac6b3531..87b91955 100644 --- a/_autosummary/poli.objective_repository.median_2.information.html +++ b/_autosummary/poli.objective_repository.median_2.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.median_2.register.html b/_autosummary/poli.objective_repository.median_2.register.html index d5b48a27..a9c34ff2 100644 --- a/_autosummary/poli.objective_repository.median_2.register.html +++ b/_autosummary/poli.objective_repository.median_2.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.mestranol_similarity.html b/_autosummary/poli.objective_repository.mestranol_similarity.html index a3bac7af..c8727534 100644 --- a/_autosummary/poli.objective_repository.mestranol_similarity.html +++ b/_autosummary/poli.objective_repository.mestranol_similarity.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.mestranol_similarity.information.html b/_autosummary/poli.objective_repository.mestranol_similarity.information.html index 754bc5f8..492c83f0 100644 --- a/_autosummary/poli.objective_repository.mestranol_similarity.information.html +++ b/_autosummary/poli.objective_repository.mestranol_similarity.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.mestranol_similarity.register.html b/_autosummary/poli.objective_repository.mestranol_similarity.register.html index 5ecbe357..0f105756 100644 --- a/_autosummary/poli.objective_repository.mestranol_similarity.register.html +++ b/_autosummary/poli.objective_repository.mestranol_similarity.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.osimetrinib_mpo.html b/_autosummary/poli.objective_repository.osimetrinib_mpo.html index d377fefb..c8833c1e 100644 --- a/_autosummary/poli.objective_repository.osimetrinib_mpo.html +++ b/_autosummary/poli.objective_repository.osimetrinib_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.osimetrinib_mpo.information.html b/_autosummary/poli.objective_repository.osimetrinib_mpo.information.html index 5f338fea..04182137 100644 --- a/_autosummary/poli.objective_repository.osimetrinib_mpo.information.html +++ b/_autosummary/poli.objective_repository.osimetrinib_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.osimetrinib_mpo.register.html b/_autosummary/poli.objective_repository.osimetrinib_mpo.register.html index 04e3be58..aa82af7e 100644 --- a/_autosummary/poli.objective_repository.osimetrinib_mpo.register.html +++ b/_autosummary/poli.objective_repository.osimetrinib_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.penalized_logp_lambo.html b/_autosummary/poli.objective_repository.penalized_logp_lambo.html index 383fb207..c1c8bcb1 100644 --- a/_autosummary/poli.objective_repository.penalized_logp_lambo.html +++ b/_autosummary/poli.objective_repository.penalized_logp_lambo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.penalized_logp_lambo.information.html b/_autosummary/poli.objective_repository.penalized_logp_lambo.information.html index d5a531c1..0aa535ba 100644 --- a/_autosummary/poli.objective_repository.penalized_logp_lambo.information.html +++ b/_autosummary/poli.objective_repository.penalized_logp_lambo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function.html b/_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function.html index 5629a4b4..5fb0ad98 100644 --- a/_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function.html +++ b/_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox.html b/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox.html index 9e0b663e..2021d6fc 100644 --- a/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox.html +++ b/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory.html b/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory.html index 3d3be580..1b3da40a 100644 --- a/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory.html +++ b/_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.penalized_logp_lambo.register.html b/_autosummary/poli.objective_repository.penalized_logp_lambo.register.html index ff24ef97..b6e53228 100644 --- a/_autosummary/poli.objective_repository.penalized_logp_lambo.register.html +++ b/_autosummary/poli.objective_repository.penalized_logp_lambo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.perindopril_mpo.html b/_autosummary/poli.objective_repository.perindopril_mpo.html index c48db267..d76d9622 100644 --- a/_autosummary/poli.objective_repository.perindopril_mpo.html +++ b/_autosummary/poli.objective_repository.perindopril_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.perindopril_mpo.information.html b/_autosummary/poli.objective_repository.perindopril_mpo.information.html index 7e692c21..12d83023 100644 --- a/_autosummary/poli.objective_repository.perindopril_mpo.information.html +++ b/_autosummary/poli.objective_repository.perindopril_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.perindopril_mpo.register.html b/_autosummary/poli.objective_repository.perindopril_mpo.register.html index aae98caa..f6c9d4f0 100644 --- a/_autosummary/poli.objective_repository.perindopril_mpo.register.html +++ b/_autosummary/poli.objective_repository.perindopril_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.ranolazine_mpo.html b/_autosummary/poli.objective_repository.ranolazine_mpo.html index 076a5642..7bc7dedf 100644 --- a/_autosummary/poli.objective_repository.ranolazine_mpo.html +++ b/_autosummary/poli.objective_repository.ranolazine_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.ranolazine_mpo.information.html b/_autosummary/poli.objective_repository.ranolazine_mpo.information.html index 98c7fc2c..310cb152 100644 --- a/_autosummary/poli.objective_repository.ranolazine_mpo.information.html +++ b/_autosummary/poli.objective_repository.ranolazine_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.ranolazine_mpo.register.html b/_autosummary/poli.objective_repository.ranolazine_mpo.register.html index d90c4d9f..59394a68 100644 --- a/_autosummary/poli.objective_repository.ranolazine_mpo.register.html +++ b/_autosummary/poli.objective_repository.ranolazine_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rasp.html b/_autosummary/poli.objective_repository.rasp.html index 3caeee1f..d991b730 100644 --- a/_autosummary/poli.objective_repository.rasp.html +++ b/_autosummary/poli.objective_repository.rasp.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rasp.information.html b/_autosummary/poli.objective_repository.rasp.information.html index 0643b25a..2f71de29 100644 --- a/_autosummary/poli.objective_repository.rasp.information.html +++ b/_autosummary/poli.objective_repository.rasp.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rasp.isolated_function.html b/_autosummary/poli.objective_repository.rasp.isolated_function.html index 2db119d5..799384fe 100644 --- a/_autosummary/poli.objective_repository.rasp.isolated_function.html +++ b/_autosummary/poli.objective_repository.rasp.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rasp.register.html b/_autosummary/poli.objective_repository.rasp.register.html index 397aeded..6e48b110 100644 --- a/_autosummary/poli.objective_repository.rasp.register.html +++ b/_autosummary/poli.objective_repository.rasp.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_logp.html b/_autosummary/poli.objective_repository.rdkit_logp.html index 4bb6d4dd..d081e7ef 100644 --- a/_autosummary/poli.objective_repository.rdkit_logp.html +++ b/_autosummary/poli.objective_repository.rdkit_logp.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_logp.information.html b/_autosummary/poli.objective_repository.rdkit_logp.information.html index 21d8ad10..2bb260a4 100644 --- a/_autosummary/poli.objective_repository.rdkit_logp.information.html +++ b/_autosummary/poli.objective_repository.rdkit_logp.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox.html b/_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox.html index dbf966ad..5912f3c0 100644 --- a/_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox.html +++ b/_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory.html b/_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory.html index 2aabb760..d12de990 100644 --- a/_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory.html +++ b/_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_logp.register.html b/_autosummary/poli.objective_repository.rdkit_logp.register.html index 81902d77..5f2f6b99 100644 --- a/_autosummary/poli.objective_repository.rdkit_logp.register.html +++ b/_autosummary/poli.objective_repository.rdkit_logp.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_qed.html b/_autosummary/poli.objective_repository.rdkit_qed.html index fa77c05d..e5eb16b7 100644 --- a/_autosummary/poli.objective_repository.rdkit_qed.html +++ b/_autosummary/poli.objective_repository.rdkit_qed.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_qed.information.html b/_autosummary/poli.objective_repository.rdkit_qed.information.html index 933753ab..de470663 100644 --- a/_autosummary/poli.objective_repository.rdkit_qed.information.html +++ b/_autosummary/poli.objective_repository.rdkit_qed.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox.html b/_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox.html index c19d45db..e87c1777 100644 --- a/_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox.html +++ b/_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory.html b/_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory.html index 4ff5c3d8..f19074b7 100644 --- a/_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory.html +++ b/_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rdkit_qed.register.html b/_autosummary/poli.objective_repository.rdkit_qed.register.html index f3db6b53..352b702d 100644 --- a/_autosummary/poli.objective_repository.rdkit_qed.register.html +++ b/_autosummary/poli.objective_repository.rdkit_qed.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.html b/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.html index d31386a3..8533618b 100644 --- a/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.html +++ b/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information.html b/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information.html index 118c6037..af8e3c87 100644 --- a/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information.html +++ b/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register.html b/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register.html index d55e62ff..213baf6a 100644 --- a/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register.html +++ b/_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rmf_landscape.html b/_autosummary/poli.objective_repository.rmf_landscape.html index 0578c580..16ae96da 100644 --- a/_autosummary/poli.objective_repository.rmf_landscape.html +++ b/_autosummary/poli.objective_repository.rmf_landscape.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rmf_landscape.information.html b/_autosummary/poli.objective_repository.rmf_landscape.information.html index 829a3944..af5b6588 100644 --- a/_autosummary/poli.objective_repository.rmf_landscape.information.html +++ b/_autosummary/poli.objective_repository.rmf_landscape.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rmf_landscape.isolated_function.html b/_autosummary/poli.objective_repository.rmf_landscape.isolated_function.html index 9c5e151d..cb15d881 100644 --- a/_autosummary/poli.objective_repository.rmf_landscape.isolated_function.html +++ b/_autosummary/poli.objective_repository.rmf_landscape.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.rmf_landscape.register.html b/_autosummary/poli.objective_repository.rmf_landscape.register.html index 5e62cbe7..97e3edce 100644 --- a/_autosummary/poli.objective_repository.rmf_landscape.register.html +++ b/_autosummary/poli.objective_repository.rmf_landscape.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sa_tdc.html b/_autosummary/poli.objective_repository.sa_tdc.html index a4bc45f0..c1a24ad7 100644 --- a/_autosummary/poli.objective_repository.sa_tdc.html +++ b/_autosummary/poli.objective_repository.sa_tdc.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sa_tdc.information.html b/_autosummary/poli.objective_repository.sa_tdc.information.html index 41ceb11f..61cc6648 100644 --- a/_autosummary/poli.objective_repository.sa_tdc.information.html +++ b/_autosummary/poli.objective_repository.sa_tdc.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sa_tdc.isolated_function.html b/_autosummary/poli.objective_repository.sa_tdc.isolated_function.html index 7eff1e58..35227d04 100644 --- a/_autosummary/poli.objective_repository.sa_tdc.isolated_function.html +++ b/_autosummary/poli.objective_repository.sa_tdc.isolated_function.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox.html b/_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox.html index 938a9142..78d714a2 100644 --- a/_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox.html +++ b/_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory.html b/_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory.html index d21b466a..9f7815ff 100644 --- a/_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory.html +++ b/_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sa_tdc.register.html b/_autosummary/poli.objective_repository.sa_tdc.register.html index 7c44e9a4..1a9960d9 100644 --- a/_autosummary/poli.objective_repository.sa_tdc.register.html +++ b/_autosummary/poli.objective_repository.sa_tdc.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.scaffold_hop.html b/_autosummary/poli.objective_repository.scaffold_hop.html index 923f6a04..15cf8c64 100644 --- a/_autosummary/poli.objective_repository.scaffold_hop.html +++ b/_autosummary/poli.objective_repository.scaffold_hop.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.scaffold_hop.information.html b/_autosummary/poli.objective_repository.scaffold_hop.information.html index 9cd93a6f..dba2871f 100644 --- a/_autosummary/poli.objective_repository.scaffold_hop.information.html +++ b/_autosummary/poli.objective_repository.scaffold_hop.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.scaffold_hop.register.html b/_autosummary/poli.objective_repository.scaffold_hop.register.html index 691ac9ca..07a689a5 100644 --- a/_autosummary/poli.objective_repository.scaffold_hop.register.html +++ b/_autosummary/poli.objective_repository.scaffold_hop.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sitagliptin_mpo.html b/_autosummary/poli.objective_repository.sitagliptin_mpo.html index c115a089..ad494d17 100644 --- a/_autosummary/poli.objective_repository.sitagliptin_mpo.html +++ b/_autosummary/poli.objective_repository.sitagliptin_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sitagliptin_mpo.information.html b/_autosummary/poli.objective_repository.sitagliptin_mpo.information.html index f78e333c..5e0fef53 100644 --- a/_autosummary/poli.objective_repository.sitagliptin_mpo.information.html +++ b/_autosummary/poli.objective_repository.sitagliptin_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.sitagliptin_mpo.register.html b/_autosummary/poli.objective_repository.sitagliptin_mpo.register.html index dd24de16..5c4a9286 100644 --- a/_autosummary/poli.objective_repository.sitagliptin_mpo.register.html +++ b/_autosummary/poli.objective_repository.sitagliptin_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.html b/_autosummary/poli.objective_repository.super_mario_bros.html index 2de2a165..bea77162 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.information.html b/_autosummary/poli.objective_repository.super_mario_bros.information.html index 1fecf6d6..0034fc88 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.information.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level.html index fe2f7680..20cc5194 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level.html index 6ac51224..2bb0cbca 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.html index 7774cd8f..e700066c 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array.html index 5a7d3c28..4790692f 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list.html index c1132e53..c1dbad42 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot.html index 60e577cd..ca240b14 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels.html index 2147f025..d08be0f6 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level.html index 2b8a4258..5d1129dc 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized.html b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized.html index 77ffde90..6c394197 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario.html b/_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario.html index a93cb43e..4f8a4375 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.model.html b/_autosummary/poli.objective_repository.super_mario_bros.model.html index 551c1d2f..6d4b0e34 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.model.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.model.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model.html b/_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model.html index 86082afa..59ddd451 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.super_mario_bros.register.html b/_autosummary/poli.objective_repository.super_mario_bros.register.html index 07a132d2..957fd449 100644 --- a/_autosummary/poli.objective_repository.super_mario_bros.register.html +++ b/_autosummary/poli.objective_repository.super_mario_bros.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.thiothixene_rediscovery.html b/_autosummary/poli.objective_repository.thiothixene_rediscovery.html index d674967d..620bcecd 100644 --- a/_autosummary/poli.objective_repository.thiothixene_rediscovery.html +++ b/_autosummary/poli.objective_repository.thiothixene_rediscovery.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.thiothixene_rediscovery.information.html b/_autosummary/poli.objective_repository.thiothixene_rediscovery.information.html index 1abc1c0f..7220a28a 100644 --- a/_autosummary/poli.objective_repository.thiothixene_rediscovery.information.html +++ b/_autosummary/poli.objective_repository.thiothixene_rediscovery.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.thiothixene_rediscovery.register.html b/_autosummary/poli.objective_repository.thiothixene_rediscovery.register.html index c041a8a4..fb299f62 100644 --- a/_autosummary/poli.objective_repository.thiothixene_rediscovery.register.html +++ b/_autosummary/poli.objective_repository.thiothixene_rediscovery.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01.html index 076cc20b..e979458b 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01.html index fde4c0da..d22c42d5 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02.html index cdd0b99e..d3648d90 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar.html index 6f5bf1a6..fc1a7e52 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown.html index 594657b4..8b1e32e3 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d.html index 4dd75c48..16c08adf 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds.html index 3cf09aa8..7e43ae54 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture.html index 38ce25fc..6ad0b210 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray.html index a0b021f8..74f2f577 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01.html index a9753574..95e77c79 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02.html index b17c4cb6..1162f297 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring.html index 5537065a..3bacfd2b 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom.html index 69471f75..1af897c4 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder.html index 7f540159..8b36b9ab 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.html index c6b256b9..bf95a0ee 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere.html index 7834dd11..8df7b32f 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang.html b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang.html index 1aba6ef2..683a978a 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.html b/_autosummary/poli.objective_repository.toy_continuous_problem.html index 894383f3..d6b38b38 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.information.html b/_autosummary/poli.objective_repository.toy_continuous_problem.information.html index 7ebd3c76..fcdaae1e 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.information.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox.html b/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox.html index adf02527..2a197e72 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory.html b/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory.html index 56217d16..05e70947 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.register.html b/_autosummary/poli.objective_repository.toy_continuous_problem.register.html index 6fd6efd6..a80ab147 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.register.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem.html b/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem.html index 055aa84f..18c845d7 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.html b/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.html index aad18067..338e64d1 100644 --- a/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.html +++ b/_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.troglitazone_rediscovery.html b/_autosummary/poli.objective_repository.troglitazone_rediscovery.html index a60c43a7..24b3bd6d 100644 --- a/_autosummary/poli.objective_repository.troglitazone_rediscovery.html +++ b/_autosummary/poli.objective_repository.troglitazone_rediscovery.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.troglitazone_rediscovery.information.html b/_autosummary/poli.objective_repository.troglitazone_rediscovery.information.html index 3c82c682..93db7a7d 100644 --- a/_autosummary/poli.objective_repository.troglitazone_rediscovery.information.html +++ b/_autosummary/poli.objective_repository.troglitazone_rediscovery.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.troglitazone_rediscovery.register.html b/_autosummary/poli.objective_repository.troglitazone_rediscovery.register.html index d31a2d09..d71df84c 100644 --- a/_autosummary/poli.objective_repository.troglitazone_rediscovery.register.html +++ b/_autosummary/poli.objective_repository.troglitazone_rediscovery.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.valsartan_smarts.html b/_autosummary/poli.objective_repository.valsartan_smarts.html index 9ec0bac8..08ba7ee6 100644 --- a/_autosummary/poli.objective_repository.valsartan_smarts.html +++ b/_autosummary/poli.objective_repository.valsartan_smarts.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.valsartan_smarts.information.html b/_autosummary/poli.objective_repository.valsartan_smarts.information.html index 072829f6..4236cbf3 100644 --- a/_autosummary/poli.objective_repository.valsartan_smarts.information.html +++ b/_autosummary/poli.objective_repository.valsartan_smarts.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.valsartan_smarts.register.html b/_autosummary/poli.objective_repository.valsartan_smarts.register.html index 8d51186e..1b5a0d0b 100644 --- a/_autosummary/poli.objective_repository.valsartan_smarts.register.html +++ b/_autosummary/poli.objective_repository.valsartan_smarts.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.white_noise.html b/_autosummary/poli.objective_repository.white_noise.html index dd49a22f..65330ae1 100644 --- a/_autosummary/poli.objective_repository.white_noise.html +++ b/_autosummary/poli.objective_repository.white_noise.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox.html b/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox.html index ec3a26cf..6382cf2a 100644 --- a/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox.html +++ b/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory.html b/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory.html index dcc39b52..2a7adc6b 100644 --- a/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory.html +++ b/_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.white_noise.register.html b/_autosummary/poli.objective_repository.white_noise.register.html index cdfb7f5a..0b020745 100644 --- a/_autosummary/poli.objective_repository.white_noise.register.html +++ b/_autosummary/poli.objective_repository.white_noise.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.zaleplon_mpo.html b/_autosummary/poli.objective_repository.zaleplon_mpo.html index dd099a38..00b80505 100644 --- a/_autosummary/poli.objective_repository.zaleplon_mpo.html +++ b/_autosummary/poli.objective_repository.zaleplon_mpo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.zaleplon_mpo.information.html b/_autosummary/poli.objective_repository.zaleplon_mpo.information.html index 708607f3..688e02ad 100644 --- a/_autosummary/poli.objective_repository.zaleplon_mpo.information.html +++ b/_autosummary/poli.objective_repository.zaleplon_mpo.information.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.objective_repository.zaleplon_mpo.register.html b/_autosummary/poli.objective_repository.zaleplon_mpo.register.html index e3c7e6bf..41794ac4 100644 --- a/_autosummary/poli.objective_repository.zaleplon_mpo.register.html +++ b/_autosummary/poli.objective_repository.zaleplon_mpo.register.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.registered_objectives.html b/_autosummary/poli.registered_objectives.html index b36aff53..9c8c0d67 100644 --- a/_autosummary/poli.registered_objectives.html +++ b/_autosummary/poli.registered_objectives.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.benchmarks.html b/_autosummary/poli.tests.benchmarks.html index 3191ef3b..53a65dee 100644 --- a/_autosummary/poli.tests.benchmarks.html +++ b/_autosummary/poli.tests.benchmarks.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.benchmarks.test_benchmark_creation.html b/_autosummary/poli.tests.benchmarks.test_benchmark_creation.html index 258e9b1c..1f8487be 100644 --- a/_autosummary/poli.tests.benchmarks.test_benchmark_creation.html +++ b/_autosummary/poli.tests.benchmarks.test_benchmark_creation.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.conftest.html b/_autosummary/poli.tests.conftest.html index 80a4d59d..451c9dee 100644 --- a/_autosummary/poli.tests.conftest.html +++ b/_autosummary/poli.tests.conftest.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.html b/_autosummary/poli.tests.docs_examples.html index 400fbf8d..0091757c 100644 --- a/_autosummary/poli.tests.docs_examples.html +++ b/_autosummary/poli.tests.docs_examples.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.html index 1ab99bbf..612bb7e1 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example.html index 274b3fbf..aef351cd 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example.html index f45412a2..29b43087 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings.html index 09802837..78e80e61 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example.html index b85fcfc1..1b3a0787 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings.html index 634b8822..4b00a30b 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example.html b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example.html index f070ae80..1c32f6a9 100644 --- a/_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example.html +++ b/_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.html b/_autosummary/poli.tests.html index 86d47371..6056caf1 100644 --- a/_autosummary/poli.tests.html +++ b/_autosummary/poli.tests.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.information.html b/_autosummary/poli.tests.information.html index 93955687..6865c189 100644 --- a/_autosummary/poli.tests.information.html +++ b/_autosummary/poli.tests.information.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.information.test_dynamic_information.html b/_autosummary/poli.tests.information.test_dynamic_information.html index cd6ba75a..268a9e36 100644 --- a/_autosummary/poli.tests.information.test_dynamic_information.html +++ b/_autosummary/poli.tests.information.test_dynamic_information.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.basic_objectives.html b/_autosummary/poli.tests.registry.basic_objectives.html index 21fb7c88..bcdbbc0a 100644 --- a/_autosummary/poli.tests.registry.basic_objectives.html +++ b/_autosummary/poli.tests.registry.basic_objectives.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.html b/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.html index e452ee80..304ff65f 100644 --- a/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.html +++ b/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha.html b/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha.html index 9e5ed974..d0f92642 100644 --- a/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha.html +++ b/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise.html b/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise.html index 37f68e6b..1ed8634e 100644 --- a/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise.html +++ b/_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion.html b/_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion.html index 3b956d2b..fcd602e9 100644 --- a/_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion.html +++ b/_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.chemistry.html b/_autosummary/poli.tests.registry.chemistry.html index d205c917..730c048f 100644 --- a/_autosummary/poli.tests.registry.chemistry.html +++ b/_autosummary/poli.tests.registry.chemistry.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives.html b/_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives.html index b9c401b6..786f6160 100644 --- a/_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives.html +++ b/_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.html b/_autosummary/poli.tests.registry.html index b3116a85..0aad3d8c 100644 --- a/_autosummary/poli.tests.registry.html +++ b/_autosummary/poli.tests.registry.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.proteins.html b/_autosummary/poli.tests.registry.proteins.html index 4a94753f..99a0576b 100644 --- a/_autosummary/poli.tests.registry.proteins.html +++ b/_autosummary/poli.tests.registry.proteins.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.proteins.test_foldx.html b/_autosummary/poli.tests.registry.proteins.test_foldx.html index ee4dfeb8..3ba39bc6 100644 --- a/_autosummary/poli.tests.registry.proteins.test_foldx.html +++ b/_autosummary/poli.tests.registry.proteins.test_foldx.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo.html b/_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo.html index 0ace9a8d..6a90079e 100644 --- a/_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo.html +++ b/_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.proteins.test_rasp.html b/_autosummary/poli.tests.registry.proteins.test_rasp.html index d8185ed0..5a1906ae 100644 --- a/_autosummary/poli.tests.registry.proteins.test_rasp.html +++ b/_autosummary/poli.tests.registry.proteins.test_rasp.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.test_basic_loop_without_create.html b/_autosummary/poli.tests.registry.test_basic_loop_without_create.html index fa88d0f5..31f03d33 100644 --- a/_autosummary/poli.tests.registry.test_basic_loop_without_create.html +++ b/_autosummary/poli.tests.registry.test_basic_loop_without_create.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.test_black_box_instancing.html b/_autosummary/poli.tests.registry.test_black_box_instancing.html index c02538ff..5a7c3cf5 100644 --- a/_autosummary/poli.tests.registry.test_black_box_instancing.html +++ b/_autosummary/poli.tests.registry.test_black_box_instancing.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.test_force_isolation.html b/_autosummary/poli.tests.registry.test_force_isolation.html index c784ba80..2739dc64 100644 --- a/_autosummary/poli.tests.registry.test_force_isolation.html +++ b/_autosummary/poli.tests.registry.test_force_isolation.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.test_instancing_black_boxes_alone.html b/_autosummary/poli.tests.registry.test_instancing_black_boxes_alone.html index 265c270b..31ebbf5e 100644 --- a/_autosummary/poli.tests.registry.test_instancing_black_boxes_alone.html +++ b/_autosummary/poli.tests.registry.test_instancing_black_boxes_alone.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.test_multi_objective_and_negative.html b/_autosummary/poli.tests.registry.test_multi_objective_and_negative.html index e322aae4..15ac53d5 100644 --- a/_autosummary/poli.tests.registry.test_multi_objective_and_negative.html +++ b/_autosummary/poli.tests.registry.test_multi_objective_and_negative.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.test_passing_array_of_strings.html b/_autosummary/poli.tests.registry.test_passing_array_of_strings.html index 33cb79d6..ee390106 100644 --- a/_autosummary/poli.tests.registry.test_passing_array_of_strings.html +++ b/_autosummary/poli.tests.registry.test_passing_array_of_strings.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.toy_continuous_problems.html b/_autosummary/poli.tests.registry.toy_continuous_problems.html index a2c34a4f..ec554b7c 100644 --- a/_autosummary/poli.tests.registry.toy_continuous_problems.html +++ b/_autosummary/poli.tests.registry.toy_continuous_problems.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.html b/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.html index 67016606..6f4601d5 100644 --- a/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.html +++ b/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions.html b/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions.html index ff4deb46..db191e6a 100644 --- a/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions.html +++ b/_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems.html b/_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems.html index 4343248d..1fa45f0f 100644 --- a/_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems.html +++ b/_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.registry.toy_discrete_problems.html b/_autosummary/poli.tests.registry.toy_discrete_problems.html index 358cce92..1eedaaa7 100644 --- a/_autosummary/poli.tests.registry.toy_discrete_problems.html +++ b/_autosummary/poli.tests.registry.toy_discrete_problems.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.test_core_promises.html b/_autosummary/poli.tests.test_core_promises.html index 4717b0ff..8cc2d574 100644 --- a/_autosummary/poli.tests.test_core_promises.html +++ b/_autosummary/poli.tests.test_core_promises.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.test_minimal_working_example.html b/_autosummary/poli.tests.test_minimal_working_example.html index b6a960c6..1592c7a3 100644 --- a/_autosummary/poli.tests.test_minimal_working_example.html +++ b/_autosummary/poli.tests.test_minimal_working_example.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example.html b/_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example.html index 183667a1..4ab06cf4 100644 --- a/_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example.html +++ b/_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.test_seeding.html b/_autosummary/poli.tests.test_seeding.html index 337f5f6c..642bc422 100644 --- a/_autosummary/poli.tests.test_seeding.html +++ b/_autosummary/poli.tests.test_seeding.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise.html b/_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise.html index 11517449..34f7ec6a 100644 --- a/_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise.html +++ b/_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.util.html b/_autosummary/poli.tests.util.html index 30c81c21..30c2ae4c 100644 --- a/_autosummary/poli.tests.util.html +++ b/_autosummary/poli.tests.util.html @@ -225,6 +225,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.util.test_foldx_interface.html b/_autosummary/poli.tests.util.test_foldx_interface.html index 4e773af1..1de1055c 100644 --- a/_autosummary/poli.tests.util.test_foldx_interface.html +++ b/_autosummary/poli.tests.util.test_foldx_interface.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_autosummary/poli.tests.util.test_protein_utilities.html b/_autosummary/poli.tests.util.test_protein_utilities.html index aa387ccb..a13171ae 100644 --- a/_autosummary/poli.tests.util.test_protein_utilities.html +++ b/_autosummary/poli.tests.util.test_protein_utilities.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/_sources/index.md b/_sources/index.md index 855d5fe3..dc69fbae 100644 --- a/_sources/index.md +++ b/_sources/index.md @@ -1,17 +1,11 @@ -# poli 🧪: a library of discrete objective functions +# `poli` 🧪: a library of discrete objective functions -[poli](https://github.com/MachineLearningLifeScience/poli) is a library of discrete objective functions for benchmarking optimization algorithms. Examples include: -- 🔬 **stability** of mutations from a wildtype protein (using [foldx](https://foldxsuite.crg.eu/) or [rasp](https://github.com/KULL-Centre/_2022_ML-ddG-Blaabjerg)). -- 🧪 **docking scores** of ligands to proteins (using [dockstring](https://github.com/dockstring/dockstring), [pyscreener](https://github.com/coleygroup/pyscreener) and [pytdc](https://tdcommons.ai/functions/oracles/)). -- 💊 **druglikeness** or **synthetic acccesibility** of small molecules (using [rdkit](https://github.com/rdkit/rdkit) and [pytdc](https://tdcommons.ai/functions/oracles/)). - -Some of `poli`'s features: -- 🔲 **isolation** of black box function calls inside conda environments. Don't worry about clashes w. black box requirements, poli will create the relevant conda environments for you. -- 🗒️ **logging** each black box call using observers. +[`poli`](https://github.com/MachineLearningLifeScience/poli) is a library of discrete objective functions for benchmarking optimization algorithms. If offers +- **isolation** of black box function calls inside conda environments. Don't worry about clashes w. black box requirements, poli will create the relevant conda environments for you. +- **logging** each black box call using observers. - A numpy interface. Inputs are `np.array`s of strings, outputs are `np.array`s of floats. -- `SMILES` and `SELFIES` support for small molecule manipulation. -This documentation also discusses [`poli-baselines`](https://github.com/MachineLearningLifeScience/poli-baselines), a collection of optimizers of these discrete black box functions. +We also provide [`poli-baselines`](https://github.com/MachineLearningLifeScience/poli-baselines), a collection of optimizers of these discrete black box functions. :::{admonition} We are running a benchmark! @@ -286,6 +280,12 @@ On top of `poli`, we provide `poli-baselines`, a collection of **black-box optim Optimizing a discrete sequence by performing random mutations ::: +:::{grid-item-card} LaMBO2 +:link: ./using_poli_baselines/lambo2.html +:columns: 6 +Optimizing protein sequences using guided discrete diffusion +::: + :::{grid-item-card} Increasingly high-dimensional combinatorial and continuous embeddings (Bounce) :link: ./using_poli_baselines/bounce.html :columns: 6 diff --git a/_sources/using_poli_baselines/lambo2.md b/_sources/using_poli_baselines/lambo2.md new file mode 100644 index 00000000..72f1ae14 --- /dev/null +++ b/_sources/using_poli_baselines/lambo2.md @@ -0,0 +1,107 @@ + +# LaMBO2 + +![Type of optimizer algorithm: proteins only](https://img.shields.io/badge/Type-proteins_only-blue) +[![LaMBO2 (py3.10 in conda)](https://github.com/MachineLearningLifeScience/poli-baselines/actions/workflows/python-tox-testing-lambo2.yml/badge.svg)](https://github.com/MachineLearningLifeScience/poli-baselines/actions/workflows/python-tox-testing-lambo2.yml) + +## About + +This is an implementation of LaMBO2 as described in {cite:p}`Gruver:Lambo2:2024`. We use the [official GitHub implementation provided by Genentech](https://github.com/prescient-design/cortex) underneath. + +:::{note} +A [tutorial on optimizing thermal stability of RFP proteins](https://github.com/MachineLearningLifeScience/poli-baselines/tree/main/examples/06_running_lambo2_on_rasp) is available in `poli-baselines`' repository. + +Another minimal example is [available on Colab](https://colab.research.google.com/drive/1otOBPvzV60_tASkGsfkJ1ng-xogdPWFJ?usp=sharing). +::: + +## How to run + +:::{warning} + +This solver runs in a different conda environment than base. You will have to install `cortex` to run it: + +```bash +pip install pytorch-cortex +``` + +::: + +```python +import numpy as np + +from poli.objective_repository import EhrlichProblemFactory + +from poli_baselines.solvers.bayesian_optimization.lambo2 import ( + LaMBO2, +) + +problem = EhrlichProblemFactory().create( + sequence_length=10, + motif_length=4, + n_motifs=2, + return_value_on_unfeasible=-1.0 +) +f, x0 = problem.black_box, problem.x0 + +solver = LaMBO2( + black_box=f, + x0=x0, +) +``` + +## See more + +- By default, `LaMBO2` runs with a conservative set-up for the underlying optimizer. [You can find the configuration here](https://github.com/MachineLearningLifeScience/poli-baselines/tree/main/src/poli_baselines/solvers/bayesian_optimization/lambo2/hydra_configs), and you can override the set-up using the `overrides` kwarg of the solver. +- [Our implementation is based on the 4th tutorial in `cortex`](https://github.com/prescient-design/cortex/tree/main/tutorials). + + +## References + +If you use this solver, we expect that you cite the following resources: + +::::{tab-set} + +:::{tab-item} References as text + +[1] Gruver, N., Stanton, S., Frey, N., Rudner, T. G. J., Hotzel, I., Lafrance-Vanasse, J., Rajpal, A., Cho, K., & Wilson, A. G. (2024). Protein design with guided discrete diffusion. Advances in Neural Information Processing Systems, 36. + +[2] González-Duque, M., Bartels, S., & Michael, R. (2024). poli: a libary of discrete sequence objectives [Computer software]. https://github.com/MachineLearningLifeScience/poli + + +::: + +:::{tab-item} References as `BibTeX` + +``` + +@article{Gruver:Lambo2:2024, + title={Protein design with guided discrete diffusion}, + author={Gruver, Nate and Stanton, Samuel and Frey, Nathan and Rudner, Tim GJ and Hotzel, Isidro and Lafrance-Vanasse, Julien and Rajpal, Arvind and Cho, Kyunghyun and Wilson, Andrew G}, + journal={Advances in Neural Information Processing Systems}, + volume={36}, + year={2024} +} + + +@software{Gonzalez-Duque:poli:2024, +author = {González-Duque, Miguel and Bartels, Simon and Michael, Richard}, +month = jan, +title = {{poli: a libary of discrete sequence objectives}}, +url = {https://github.com/MachineLearningLifeScience/poli}, +version = {0.0.1}, +year = {2024} +} + +``` + +::: + +:::: + +## API reference + +```{eval-rst} +.. autoclass:: poli_baselines.solvers.bayesian_optimization.lambo2.LaMBO2 + :members: +``` + diff --git a/_templates/custom-module-template.html b/_templates/custom-module-template.html index e6311f4f..82da445c 100644 --- a/_templates/custom-module-template.html +++ b/_templates/custom-module-template.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/api.html b/api.html index f65ccc94..8dbb28b4 100644 --- a/api.html +++ b/api.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/bibliography.html b/bibliography.html index 56142a39..f968b3ea 100644 --- a/bibliography.html +++ b/bibliography.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • @@ -732,6 +733,9 @@

    ReferencesGPB+18

    Jacob R Gardner, Geoff Pleiss, David Bindel, Kilian Q Weinberger, and Andrew Gordon Wilson. Gpytorch: blackbox matrix-matrix gaussian process inference with gpu acceleration. In Advances in Neural Information Processing Systems. 2018.

    +
    GSF+24
    +

    Nate Gruver, Samuel Stanton, Nathan Frey, Tim GJ Rudner, Isidro Hotzel, Julien Lafrance-Vanasse, Arvind Rajpal, Kyunghyun Cho, and Andrew G Wilson. Protein design with guided discrete diffusion. Advances in Neural Information Processing Systems, 2024.

    +
    GBWD+18

    Rafael Gómez-Bombarelli, Jennifer N. Wei, David Duvenaud, José Miguel Hernández-Lobato, Benjamín Sánchez-Lengeling, Dennis Sheberla, Jorge Aguilera-Iparraguirre, Timothy D. Hirzel, Ryan P. Adams, and Alán Aspuru-Guzik. Automatic chemical design using a data-driven continuous representation of molecules. ACS Central Science, 4(2):268–276, February 2018. doi:10.1021/acscentsci.7b00572.

    diff --git a/contributing/a_new_problem.html b/contributing/a_new_problem.html index 9b439f43..a21eccb6 100644 --- a/contributing/a_new_problem.html +++ b/contributing/a_new_problem.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/contributing/a_new_solver.html b/contributing/a_new_solver.html index d1040ba3..5aa9fa01 100644 --- a/contributing/a_new_solver.html +++ b/contributing/a_new_solver.html @@ -227,6 +227,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • diff --git a/genindex.html b/genindex.html index cd69aedd..ebe041fe 100644 --- a/genindex.html +++ b/genindex.html @@ -226,6 +226,7 @@
  • Random mutations
  • CMA-ES
  • Line Bayesian Optimization
    • +
  • LaMBO2
  • Hvarfner’s Vanilla Bayesian Optimization
  • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
  • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
    • @@ -652,6 +653,7 @@

    Index

    | E | F | G + | H | I | L | M @@ -1030,6 +1032,8 @@

    G

  • get_argmax() (in module poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing)
  • get_balaji_predictions() (in module poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing) +
    • +
  • get_candidate_points_from_history() (poli_baselines.solvers.bayesian_optimization.lambo2.LaMBO2 method)
  • get_connection() (in module poli.core.util.inter_process_communication.process_wrapper)
    • @@ -1054,6 +1058,14 @@

    G

    +

    H

    + + +
    +

    I

      @@ -1073,6 +1085,8 @@

      I

      L

      - +
      • smiles_to_molecules() (in module poli.core.util.chemistry.string_to_molecule) +
        • +
      • solve() (poli_baselines.solvers.bayesian_optimization.lambo2.LaMBO2 method)
      • start() (in module poli.objective_factory)
      • start_observer_process() (in module poli.core.util.observer_wrapper) +
        • +
      • step() (poli_baselines.solvers.bayesian_optimization.lambo2.LaMBO2 method)
      • strings_to_molecules() (in module poli.core.util.chemistry.string_to_molecule)
        • diff --git a/getting_started/getting_started.html b/getting_started/getting_started.html index d30ff6a7..8411fed6 100644 --- a/getting_started/getting_started.html +++ b/getting_started/getting_started.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • @@ -858,7 +859,7 @@

        Your first script using

        previous

        -

        poli 🧪: a library of discrete objective functions

        +

        poli 🧪: a library of discrete objective functions

        Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • @@ -714,21 +715,14 @@

        Contents

        -

        poli 🧪: a library of discrete objective functions#

        -

        poli is a library of discrete objective functions for benchmarking optimization algorithms. Examples include:

        +

        poli 🧪: a library of discrete objective functions#

        +

        poli is a library of discrete objective functions for benchmarking optimization algorithms. If offers

          -

        • 🔬 stability of mutations from a wildtype protein (using foldx or rasp).

          • -

        • 🧪 docking scores of ligands to proteins (using dockstring, pyscreener and pytdc).

          • -

        • 💊 druglikeness or synthetic acccesibility of small molecules (using rdkit and pytdc).

          • -
        -

        Some of poli’s features:

        -
          -

        • 🔲 isolation of black box function calls inside conda environments. Don’t worry about clashes w. black box requirements, poli will create the relevant conda environments for you.

          • -

        • 🗒️ logging each black box call using observers.

          • +

        • isolation of black box function calls inside conda environments. Don’t worry about clashes w. black box requirements, poli will create the relevant conda environments for you.

          • +

        • logging each black box call using observers.

        • A numpy interface. Inputs are np.arrays of strings, outputs are np.arrays of floats.

          • -

        • SMILES and SELFIES support for small molecule manipulation.

        -

        This documentation also discusses poli-baselines, a collection of optimizers of these discrete black box functions.

        +

        We also provide poli-baselines, a collection of optimizers of these discrete black box functions.

        We are running a benchmark!

        Using poli and poli-baselines, we are running a benchmark comparing high-dimensional Bayesian optimization algorithms for discrete sequence.

        @@ -1105,6 +1099,15 @@

        Discrete
        +LaMBO2
        +

        Optimizing protein sequences using guided discrete diffusion

        +
        +

        + +
        +
        +
        +
        Increasingly high-dimensional combinatorial and continuous embeddings (Bounce)

        Papenmeier et al’s Bounce, using their official implementation.

        diff --git a/objects.inv b/objects.inv index 1468f164..3a8b33b1 100644 Binary files a/objects.inv and b/objects.inv differ diff --git a/py-modindex.html b/py-modindex.html index 18d6ac2a..9c275e05 100644 --- a/py-modindex.html +++ b/py-modindex.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/search.html b/search.html index bc3dc132..0d680831 100644 --- a/search.html +++ b/search.html @@ -228,6 +228,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/searchindex.js b/searchindex.js index 8548d61e..ea025005 100644 --- a/searchindex.js +++ b/searchindex.js @@ -1 +1 @@ -Search.setIndex({"docnames": ["_autosummary/poli", "_autosummary/poli.core", "_autosummary/poli.core.abstract_benchmark", "_autosummary/poli.core.abstract_black_box", "_autosummary/poli.core.abstract_black_box.AbstractBlackBox", "_autosummary/poli.core.abstract_black_box.NegativeBlackBox", "_autosummary/poli.core.abstract_isolated_function", "_autosummary/poli.core.abstract_problem_factory", "_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory", "_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory", "_autosummary/poli.core.benchmark_information", "_autosummary/poli.core.black_box_information", "_autosummary/poli.core.chemistry", "_autosummary/poli.core.chemistry.tdc_black_box", "_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox", "_autosummary/poli.core.chemistry.tdc_isolated_function", "_autosummary/poli.core.exceptions", "_autosummary/poli.core.exceptions.BudgetExhaustedException", "_autosummary/poli.core.exceptions.PoliException", "_autosummary/poli.core.multi_objective_black_box", "_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox", "_autosummary/poli.core.problem", "_autosummary/poli.core.problem_setup_information", "_autosummary/poli.core.problem_setup_information.ProblemSetupInformation", "_autosummary/poli.core.proteins", "_autosummary/poli.core.proteins.foldx_black_box", "_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox", "_autosummary/poli.core.proteins.foldx_isolated_function", "_autosummary/poli.core.registry", "_autosummary/poli.core.registry.delete_observer_run_script", "_autosummary/poli.core.registry.delete_problem", "_autosummary/poli.core.registry.get_problem_factories", "_autosummary/poli.core.registry.get_problems", "_autosummary/poli.core.registry.register_problem", "_autosummary/poli.core.registry.register_problem_from_repository", "_autosummary/poli.core.registry.set_observer", "_autosummary/poli.core.registry.set_observer_run_script", "_autosummary/poli.core.util", "_autosummary/poli.core.util.abstract_observer", "_autosummary/poli.core.util.abstract_observer.AbstractObserver", "_autosummary/poli.core.util.algorithm_observer_wrapper", "_autosummary/poli.core.util.alignment", "_autosummary/poli.core.util.alignment.is_aligned", "_autosummary/poli.core.util.batch", "_autosummary/poli.core.util.batch.batch_input", "_autosummary/poli.core.util.batch.batch_input.batched", "_autosummary/poli.core.util.chemistry", "_autosummary/poli.core.util.chemistry.string_to_molecule", "_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules", "_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules", "_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies", "_autosummary/poli.core.util.default_observer", "_autosummary/poli.core.util.external_observer", "_autosummary/poli.core.util.external_observer.ExternalObserver", "_autosummary/poli.core.util.files", "_autosummary/poli.core.util.files.download_files_from_github", "_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository", "_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag", "_autosummary/poli.core.util.files.integrity", "_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath", "_autosummary/poli.core.util.inter_process_communication", "_autosummary/poli.core.util.inter_process_communication.process_wrapper", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection", "_autosummary/poli.core.util.isolation", "_autosummary/poli.core.util.isolation.external_black_box", "_autosummary/poli.core.util.isolation.external_function", "_autosummary/poli.core.util.isolation.instancing", "_autosummary/poli.core.util.isolation.isolated_black_box", "_autosummary/poli.core.util.multi_observer", "_autosummary/poli.core.util.objective_management", "_autosummary/poli.core.util.objective_management.make_run_script", "_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script", "_autosummary/poli.core.util.objective_management.make_run_script.make_run_script", "_autosummary/poli.core.util.observer_wrapper", "_autosummary/poli.core.util.observer_wrapper.start_observer_process", "_autosummary/poli.core.util.proteins", "_autosummary/poli.core.util.proteins.defaults", "_autosummary/poli.core.util.proteins.foldx", "_autosummary/poli.core.util.proteins.foldx.FoldxInterface", "_autosummary/poli.core.util.proteins.mutations", "_autosummary/poli.core.util.proteins.mutations.edits_between_strings", "_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant", "_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant", "_autosummary/poli.core.util.proteins.pdb_parsing", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure", "_autosummary/poli.core.util.proteins.rasp", "_autosummary/poli.core.util.proteins.rasp.inner_rasp", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization", "_autosummary/poli.core.util.proteins.rasp.load_models", "_autosummary/poli.core.util.proteins.rasp.rasp_interface", "_autosummary/poli.core.util.seeding", "_autosummary/poli.core.util.seeding.seeding", "_autosummary/poli.core.util.seeding.seeding.seed_numpy", "_autosummary/poli.core.util.seeding.seeding.seed_python", "_autosummary/poli.objective", "_autosummary/poli.objective.dynamically_instantiate", "_autosummary/poli.objective.parse_factory_kwargs", "_autosummary/poli.objective.run", "_autosummary/poli.objective_factory", "_autosummary/poli.objective_factory.ExternalBlackBox", "_autosummary/poli.objective_factory.create", "_autosummary/poli.objective_factory.load_config", "_autosummary/poli.objective_factory.start", "_autosummary/poli.objective_repository", "_autosummary/poli.objective_repository.albuterol_similarity", "_autosummary/poli.objective_repository.albuterol_similarity.information", "_autosummary/poli.objective_repository.albuterol_similarity.register", "_autosummary/poli.objective_repository.aloha", "_autosummary/poli.objective_repository.aloha.register", "_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox", "_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory", "_autosummary/poli.objective_repository.amlodipine_mpo", "_autosummary/poli.objective_repository.amlodipine_mpo.information", "_autosummary/poli.objective_repository.amlodipine_mpo.register", "_autosummary/poli.objective_repository.celecoxib_rediscovery", "_autosummary/poli.objective_repository.celecoxib_rediscovery.information", "_autosummary/poli.objective_repository.celecoxib_rediscovery.register", "_autosummary/poli.objective_repository.deco_hop", "_autosummary/poli.objective_repository.deco_hop.information", "_autosummary/poli.objective_repository.deco_hop.register", "_autosummary/poli.objective_repository.dockstring", "_autosummary/poli.objective_repository.dockstring.information", "_autosummary/poli.objective_repository.dockstring.isolated_function", "_autosummary/poli.objective_repository.dockstring.register", "_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox", "_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory", "_autosummary/poli.objective_repository.drd2_docking", "_autosummary/poli.objective_repository.drd2_docking.information", "_autosummary/poli.objective_repository.drd2_docking.register", "_autosummary/poli.objective_repository.drd3_docking", "_autosummary/poli.objective_repository.drd3_docking.information", "_autosummary/poli.objective_repository.drd3_docking.isolated_function", "_autosummary/poli.objective_repository.drd3_docking.register", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory", "_autosummary/poli.objective_repository.ehrlich", "_autosummary/poli.objective_repository.ehrlich.information", "_autosummary/poli.objective_repository.ehrlich.register", "_autosummary/poli.objective_repository.fexofenadine_mpo", "_autosummary/poli.objective_repository.fexofenadine_mpo.information", "_autosummary/poli.objective_repository.fexofenadine_mpo.register", "_autosummary/poli.objective_repository.foldx_rfp_lambo", "_autosummary/poli.objective_repository.foldx_rfp_lambo.information", "_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config", "_autosummary/poli.objective_repository.foldx_sasa", "_autosummary/poli.objective_repository.foldx_sasa.foldx_utils", "_autosummary/poli.objective_repository.foldx_sasa.information", "_autosummary/poli.objective_repository.foldx_sasa.isolated_function", "_autosummary/poli.objective_repository.foldx_sasa.register", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory", "_autosummary/poli.objective_repository.foldx_stability", "_autosummary/poli.objective_repository.foldx_stability.foldx_utils", "_autosummary/poli.objective_repository.foldx_stability.information", "_autosummary/poli.objective_repository.foldx_stability.isolated_function", "_autosummary/poli.objective_repository.foldx_stability.register", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory", "_autosummary/poli.objective_repository.foldx_stability_and_sasa", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.information", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory", "_autosummary/poli.objective_repository.gfp_cbas", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder", "_autosummary/poli.objective_repository.gfp_cbas.gfp_gp", "_autosummary/poli.objective_repository.gfp_cbas.information", "_autosummary/poli.objective_repository.gfp_cbas.isolated_function", "_autosummary/poli.objective_repository.gfp_cbas.make_vae", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy", "_autosummary/poli.objective_repository.gfp_cbas.register", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory", "_autosummary/poli.objective_repository.gfp_select", "_autosummary/poli.objective_repository.gfp_select.information", "_autosummary/poli.objective_repository.gfp_select.isolated_function", "_autosummary/poli.objective_repository.gfp_select.register", "_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox", "_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory", "_autosummary/poli.objective_repository.gsk3_beta", "_autosummary/poli.objective_repository.gsk3_beta.information", "_autosummary/poli.objective_repository.gsk3_beta.register", "_autosummary/poli.objective_repository.isomer_c7h8n2o2", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.information", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.register", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register", "_autosummary/poli.objective_repository.jnk3", "_autosummary/poli.objective_repository.jnk3.information", "_autosummary/poli.objective_repository.jnk3.register", "_autosummary/poli.objective_repository.median_1", "_autosummary/poli.objective_repository.median_1.information", "_autosummary/poli.objective_repository.median_1.register", "_autosummary/poli.objective_repository.median_2", "_autosummary/poli.objective_repository.median_2.information", "_autosummary/poli.objective_repository.median_2.register", "_autosummary/poli.objective_repository.mestranol_similarity", "_autosummary/poli.objective_repository.mestranol_similarity.information", "_autosummary/poli.objective_repository.mestranol_similarity.register", "_autosummary/poli.objective_repository.osimetrinib_mpo", "_autosummary/poli.objective_repository.osimetrinib_mpo.information", "_autosummary/poli.objective_repository.osimetrinib_mpo.register", "_autosummary/poli.objective_repository.penalized_logp_lambo", "_autosummary/poli.objective_repository.penalized_logp_lambo.information", "_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function", "_autosummary/poli.objective_repository.penalized_logp_lambo.register", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory", "_autosummary/poli.objective_repository.perindopril_mpo", "_autosummary/poli.objective_repository.perindopril_mpo.information", "_autosummary/poli.objective_repository.perindopril_mpo.register", "_autosummary/poli.objective_repository.ranolazine_mpo", "_autosummary/poli.objective_repository.ranolazine_mpo.information", "_autosummary/poli.objective_repository.ranolazine_mpo.register", "_autosummary/poli.objective_repository.rasp", "_autosummary/poli.objective_repository.rasp.information", "_autosummary/poli.objective_repository.rasp.isolated_function", "_autosummary/poli.objective_repository.rasp.register", "_autosummary/poli.objective_repository.rdkit_logp", "_autosummary/poli.objective_repository.rdkit_logp.information", "_autosummary/poli.objective_repository.rdkit_logp.register", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory", "_autosummary/poli.objective_repository.rdkit_qed", "_autosummary/poli.objective_repository.rdkit_qed.information", "_autosummary/poli.objective_repository.rdkit_qed.register", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register", "_autosummary/poli.objective_repository.rmf_landscape", "_autosummary/poli.objective_repository.rmf_landscape.information", "_autosummary/poli.objective_repository.rmf_landscape.isolated_function", "_autosummary/poli.objective_repository.rmf_landscape.register", "_autosummary/poli.objective_repository.sa_tdc", "_autosummary/poli.objective_repository.sa_tdc.information", "_autosummary/poli.objective_repository.sa_tdc.isolated_function", "_autosummary/poli.objective_repository.sa_tdc.register", "_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox", "_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory", "_autosummary/poli.objective_repository.scaffold_hop", "_autosummary/poli.objective_repository.scaffold_hop.information", "_autosummary/poli.objective_repository.scaffold_hop.register", "_autosummary/poli.objective_repository.sitagliptin_mpo", "_autosummary/poli.objective_repository.sitagliptin_mpo.information", "_autosummary/poli.objective_repository.sitagliptin_mpo.register", "_autosummary/poli.objective_repository.super_mario_bros", "_autosummary/poli.objective_repository.super_mario_bros.information", "_autosummary/poli.objective_repository.super_mario_bros.level_utils", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized", "_autosummary/poli.objective_repository.super_mario_bros.model", "_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario", "_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model", "_autosummary/poli.objective_repository.super_mario_bros.register", "_autosummary/poli.objective_repository.thiothixene_rediscovery", "_autosummary/poli.objective_repository.thiothixene_rediscovery.information", "_autosummary/poli.objective_repository.thiothixene_rediscovery.register", "_autosummary/poli.objective_repository.toy_continuous_problem", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang", "_autosummary/poli.objective_repository.toy_continuous_problem.information", "_autosummary/poli.objective_repository.toy_continuous_problem.register", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem", "_autosummary/poli.objective_repository.troglitazone_rediscovery", "_autosummary/poli.objective_repository.troglitazone_rediscovery.information", "_autosummary/poli.objective_repository.troglitazone_rediscovery.register", "_autosummary/poli.objective_repository.valsartan_smarts", "_autosummary/poli.objective_repository.valsartan_smarts.information", "_autosummary/poli.objective_repository.valsartan_smarts.register", "_autosummary/poli.objective_repository.white_noise", "_autosummary/poli.objective_repository.white_noise.register", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory", "_autosummary/poli.objective_repository.zaleplon_mpo", "_autosummary/poli.objective_repository.zaleplon_mpo.information", "_autosummary/poli.objective_repository.zaleplon_mpo.register", "_autosummary/poli.registered_objectives", "_autosummary/poli.tests", "_autosummary/poli.tests.benchmarks", "_autosummary/poli.tests.benchmarks.test_benchmark_creation", "_autosummary/poli.tests.conftest", "_autosummary/poli.tests.docs_examples", "_autosummary/poli.tests.docs_examples.test_objective_functions", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example", "_autosummary/poli.tests.information", "_autosummary/poli.tests.information.test_dynamic_information", "_autosummary/poli.tests.registry", "_autosummary/poli.tests.registry.basic_objectives", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise", "_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion", "_autosummary/poli.tests.registry.chemistry", "_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives", "_autosummary/poli.tests.registry.proteins", "_autosummary/poli.tests.registry.proteins.test_foldx", "_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo", "_autosummary/poli.tests.registry.proteins.test_rasp", "_autosummary/poli.tests.registry.test_basic_loop_without_create", "_autosummary/poli.tests.registry.test_black_box_instancing", "_autosummary/poli.tests.registry.test_force_isolation", "_autosummary/poli.tests.registry.test_instancing_black_boxes_alone", "_autosummary/poli.tests.registry.test_multi_objective_and_negative", "_autosummary/poli.tests.registry.test_passing_array_of_strings", "_autosummary/poli.tests.registry.toy_continuous_problems", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions", "_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems", "_autosummary/poli.tests.registry.toy_discrete_problems", "_autosummary/poli.tests.test_core_promises", "_autosummary/poli.tests.test_minimal_working_example", "_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example", "_autosummary/poli.tests.test_seeding", "_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise", "_autosummary/poli.tests.util", "_autosummary/poli.tests.util.test_foldx_interface", "_autosummary/poli.tests.util.test_protein_utilities", "_templates/custom-module-template", "api", "bibliography", "contributing/a_new_problem", "contributing/a_new_solver", "getting_started/getting_started", "index", "understanding_foldx/00-installing-foldx", "understanding_foldx/01-single-mutation-using-foldx/index", "using_poli/objective_repository/RaSP", "using_poli/objective_repository/albuterol_similarity", "using_poli/objective_repository/all_objectives", "using_poli/objective_repository/aloha", "using_poli/objective_repository/amlodipine_mpo", "using_poli/objective_repository/celecoxib_rediscovery", "using_poli/objective_repository/deco_hop", "using_poli/objective_repository/dockstring", "using_poli/objective_repository/drd2_docking", "using_poli/objective_repository/drd3_docking", "using_poli/objective_repository/ehrlich_functions", "using_poli/objective_repository/fexofenadine_mpo", "using_poli/objective_repository/foldx_rfp_lambo", "using_poli/objective_repository/foldx_sasa", "using_poli/objective_repository/foldx_stability", "using_poli/objective_repository/gsk3_beta", "using_poli/objective_repository/isomer_c7h8n2o2", "using_poli/objective_repository/isomer_c9h10n2o2pf2cl", "using_poli/objective_repository/jnk3", "using_poli/objective_repository/median_1", "using_poli/objective_repository/median_2", "using_poli/objective_repository/mestranol_similarity", "using_poli/objective_repository/osimetrinib_mpo", "using_poli/objective_repository/penalized_logp_lambo", "using_poli/objective_repository/ranolazine_mpo", "using_poli/objective_repository/rdkit_logp", "using_poli/objective_repository/rdkit_qed", "using_poli/objective_repository/sa_tdc", "using_poli/objective_repository/scaffold_hop", "using_poli/objective_repository/sitagliptin_mpo", "using_poli/objective_repository/super_mario_bros", "using_poli/objective_repository/template", "using_poli/objective_repository/thiothixene_rediscovery", "using_poli/objective_repository/toy_continuous_problems", "using_poli/objective_repository/troglitazone_rediscovery", "using_poli/objective_repository/valsartan_smarts", "using_poli/objective_repository/white_noise", "using_poli/objective_repository/zaleplon_mpo", "using_poli/observers/registering_an_observer", "using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability", "using_poli/the_basics/defining_a_problem_solver", "using_poli/the_basics/defining_an_observer", "using_poli/the_basics/diving_deeper", "using_poli/the_basics/intro_to_poli", "using_poli/the_basics/isolation", "using_poli_baselines/alebo", "using_poli_baselines/baxus", "using_poli_baselines/bayesian_optimization", "using_poli_baselines/bounce", "using_poli_baselines/cma_es", "using_poli_baselines/graph_ga", "using_poli_baselines/hvarfners_vanilla_bo", "using_poli_baselines/latent_space_bo", "using_poli_baselines/line_bayesian_optimization", "using_poli_baselines/nsga_2", "using_poli_baselines/probrep", "using_poli_baselines/random_mutations", "using_poli_baselines/saasbo", "using_poli_baselines/template", "using_poli_baselines/turbo"], "filenames": ["_autosummary/poli.rst", "_autosummary/poli.core.rst", "_autosummary/poli.core.abstract_benchmark.rst", "_autosummary/poli.core.abstract_black_box.rst", "_autosummary/poli.core.abstract_black_box.AbstractBlackBox.rst", "_autosummary/poli.core.abstract_black_box.NegativeBlackBox.rst", "_autosummary/poli.core.abstract_isolated_function.rst", "_autosummary/poli.core.abstract_problem_factory.rst", "_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory.rst", "_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory.rst", "_autosummary/poli.core.benchmark_information.rst", "_autosummary/poli.core.black_box_information.rst", "_autosummary/poli.core.chemistry.rst", "_autosummary/poli.core.chemistry.tdc_black_box.rst", "_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox.rst", "_autosummary/poli.core.chemistry.tdc_isolated_function.rst", "_autosummary/poli.core.exceptions.rst", "_autosummary/poli.core.exceptions.BudgetExhaustedException.rst", "_autosummary/poli.core.exceptions.PoliException.rst", "_autosummary/poli.core.multi_objective_black_box.rst", "_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox.rst", "_autosummary/poli.core.problem.rst", "_autosummary/poli.core.problem_setup_information.rst", "_autosummary/poli.core.problem_setup_information.ProblemSetupInformation.rst", "_autosummary/poli.core.proteins.rst", "_autosummary/poli.core.proteins.foldx_black_box.rst", "_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox.rst", "_autosummary/poli.core.proteins.foldx_isolated_function.rst", "_autosummary/poli.core.registry.rst", "_autosummary/poli.core.registry.delete_observer_run_script.rst", "_autosummary/poli.core.registry.delete_problem.rst", "_autosummary/poli.core.registry.get_problem_factories.rst", "_autosummary/poli.core.registry.get_problems.rst", "_autosummary/poli.core.registry.register_problem.rst", "_autosummary/poli.core.registry.register_problem_from_repository.rst", "_autosummary/poli.core.registry.set_observer.rst", "_autosummary/poli.core.registry.set_observer_run_script.rst", "_autosummary/poli.core.util.rst", "_autosummary/poli.core.util.abstract_observer.rst", "_autosummary/poli.core.util.abstract_observer.AbstractObserver.rst", "_autosummary/poli.core.util.algorithm_observer_wrapper.rst", "_autosummary/poli.core.util.alignment.rst", "_autosummary/poli.core.util.alignment.is_aligned.rst", "_autosummary/poli.core.util.batch.rst", "_autosummary/poli.core.util.batch.batch_input.rst", "_autosummary/poli.core.util.batch.batch_input.batched.rst", "_autosummary/poli.core.util.chemistry.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies.rst", "_autosummary/poli.core.util.default_observer.rst", "_autosummary/poli.core.util.external_observer.rst", "_autosummary/poli.core.util.external_observer.ExternalObserver.rst", "_autosummary/poli.core.util.files.rst", "_autosummary/poli.core.util.files.download_files_from_github.rst", "_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository.rst", "_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag.rst", "_autosummary/poli.core.util.files.integrity.rst", "_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath.rst", "_autosummary/poli.core.util.inter_process_communication.rst", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.rst", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper.rst", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection.rst", "_autosummary/poli.core.util.isolation.rst", "_autosummary/poli.core.util.isolation.external_black_box.rst", "_autosummary/poli.core.util.isolation.external_function.rst", "_autosummary/poli.core.util.isolation.instancing.rst", "_autosummary/poli.core.util.isolation.isolated_black_box.rst", "_autosummary/poli.core.util.multi_observer.rst", "_autosummary/poli.core.util.objective_management.rst", "_autosummary/poli.core.util.objective_management.make_run_script.rst", "_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script.rst", "_autosummary/poli.core.util.objective_management.make_run_script.make_run_script.rst", "_autosummary/poli.core.util.observer_wrapper.rst", "_autosummary/poli.core.util.observer_wrapper.start_observer_process.rst", "_autosummary/poli.core.util.proteins.rst", "_autosummary/poli.core.util.proteins.defaults.rst", "_autosummary/poli.core.util.proteins.foldx.rst", "_autosummary/poli.core.util.proteins.foldx.FoldxInterface.rst", "_autosummary/poli.core.util.proteins.mutations.rst", "_autosummary/poli.core.util.proteins.mutations.edits_between_strings.rst", "_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant.rst", "_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure.rst", "_autosummary/poli.core.util.proteins.rasp.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization.rst", "_autosummary/poli.core.util.proteins.rasp.load_models.rst", "_autosummary/poli.core.util.proteins.rasp.rasp_interface.rst", "_autosummary/poli.core.util.seeding.rst", "_autosummary/poli.core.util.seeding.seeding.rst", "_autosummary/poli.core.util.seeding.seeding.seed_numpy.rst", "_autosummary/poli.core.util.seeding.seeding.seed_python.rst", "_autosummary/poli.objective.rst", "_autosummary/poli.objective.dynamically_instantiate.rst", "_autosummary/poli.objective.parse_factory_kwargs.rst", "_autosummary/poli.objective.run.rst", "_autosummary/poli.objective_factory.rst", "_autosummary/poli.objective_factory.ExternalBlackBox.rst", "_autosummary/poli.objective_factory.create.rst", "_autosummary/poli.objective_factory.load_config.rst", "_autosummary/poli.objective_factory.start.rst", "_autosummary/poli.objective_repository.rst", "_autosummary/poli.objective_repository.albuterol_similarity.rst", "_autosummary/poli.objective_repository.albuterol_similarity.information.rst", "_autosummary/poli.objective_repository.albuterol_similarity.register.rst", "_autosummary/poli.objective_repository.aloha.rst", "_autosummary/poli.objective_repository.aloha.register.rst", "_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox.rst", "_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory.rst", "_autosummary/poli.objective_repository.amlodipine_mpo.rst", "_autosummary/poli.objective_repository.amlodipine_mpo.information.rst", "_autosummary/poli.objective_repository.amlodipine_mpo.register.rst", "_autosummary/poli.objective_repository.celecoxib_rediscovery.rst", "_autosummary/poli.objective_repository.celecoxib_rediscovery.information.rst", "_autosummary/poli.objective_repository.celecoxib_rediscovery.register.rst", "_autosummary/poli.objective_repository.deco_hop.rst", "_autosummary/poli.objective_repository.deco_hop.information.rst", "_autosummary/poli.objective_repository.deco_hop.register.rst", "_autosummary/poli.objective_repository.dockstring.rst", "_autosummary/poli.objective_repository.dockstring.information.rst", "_autosummary/poli.objective_repository.dockstring.isolated_function.rst", "_autosummary/poli.objective_repository.dockstring.register.rst", "_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox.rst", "_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory.rst", "_autosummary/poli.objective_repository.drd2_docking.rst", "_autosummary/poli.objective_repository.drd2_docking.information.rst", "_autosummary/poli.objective_repository.drd2_docking.register.rst", "_autosummary/poli.objective_repository.drd3_docking.rst", "_autosummary/poli.objective_repository.drd3_docking.information.rst", "_autosummary/poli.objective_repository.drd3_docking.isolated_function.rst", "_autosummary/poli.objective_repository.drd3_docking.register.rst", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox.rst", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory.rst", "_autosummary/poli.objective_repository.ehrlich.rst", "_autosummary/poli.objective_repository.ehrlich.information.rst", "_autosummary/poli.objective_repository.ehrlich.register.rst", "_autosummary/poli.objective_repository.fexofenadine_mpo.rst", "_autosummary/poli.objective_repository.fexofenadine_mpo.information.rst", "_autosummary/poli.objective_repository.fexofenadine_mpo.register.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.information.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config.rst", "_autosummary/poli.objective_repository.foldx_sasa.rst", "_autosummary/poli.objective_repository.foldx_sasa.foldx_utils.rst", "_autosummary/poli.objective_repository.foldx_sasa.information.rst", "_autosummary/poli.objective_repository.foldx_sasa.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_sasa.register.rst", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox.rst", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory.rst", "_autosummary/poli.objective_repository.foldx_stability.rst", "_autosummary/poli.objective_repository.foldx_stability.foldx_utils.rst", "_autosummary/poli.objective_repository.foldx_stability.information.rst", "_autosummary/poli.objective_repository.foldx_stability.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_stability.register.rst", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox.rst", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.information.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory.rst", "_autosummary/poli.objective_repository.gfp_cbas.rst", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder.rst", "_autosummary/poli.objective_repository.gfp_cbas.gfp_gp.rst", "_autosummary/poli.objective_repository.gfp_cbas.information.rst", "_autosummary/poli.objective_repository.gfp_cbas.isolated_function.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy.rst", "_autosummary/poli.objective_repository.gfp_cbas.register.rst", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox.rst", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory.rst", "_autosummary/poli.objective_repository.gfp_select.rst", "_autosummary/poli.objective_repository.gfp_select.information.rst", "_autosummary/poli.objective_repository.gfp_select.isolated_function.rst", "_autosummary/poli.objective_repository.gfp_select.register.rst", "_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox.rst", "_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory.rst", "_autosummary/poli.objective_repository.gsk3_beta.rst", "_autosummary/poli.objective_repository.gsk3_beta.information.rst", "_autosummary/poli.objective_repository.gsk3_beta.register.rst", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.rst", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.information.rst", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.register.rst", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.rst", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information.rst", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register.rst", "_autosummary/poli.objective_repository.jnk3.rst", "_autosummary/poli.objective_repository.jnk3.information.rst", "_autosummary/poli.objective_repository.jnk3.register.rst", "_autosummary/poli.objective_repository.median_1.rst", "_autosummary/poli.objective_repository.median_1.information.rst", "_autosummary/poli.objective_repository.median_1.register.rst", "_autosummary/poli.objective_repository.median_2.rst", "_autosummary/poli.objective_repository.median_2.information.rst", "_autosummary/poli.objective_repository.median_2.register.rst", "_autosummary/poli.objective_repository.mestranol_similarity.rst", "_autosummary/poli.objective_repository.mestranol_similarity.information.rst", "_autosummary/poli.objective_repository.mestranol_similarity.register.rst", "_autosummary/poli.objective_repository.osimetrinib_mpo.rst", "_autosummary/poli.objective_repository.osimetrinib_mpo.information.rst", "_autosummary/poli.objective_repository.osimetrinib_mpo.register.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.information.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory.rst", "_autosummary/poli.objective_repository.perindopril_mpo.rst", "_autosummary/poli.objective_repository.perindopril_mpo.information.rst", "_autosummary/poli.objective_repository.perindopril_mpo.register.rst", "_autosummary/poli.objective_repository.ranolazine_mpo.rst", "_autosummary/poli.objective_repository.ranolazine_mpo.information.rst", "_autosummary/poli.objective_repository.ranolazine_mpo.register.rst", "_autosummary/poli.objective_repository.rasp.rst", "_autosummary/poli.objective_repository.rasp.information.rst", "_autosummary/poli.objective_repository.rasp.isolated_function.rst", "_autosummary/poli.objective_repository.rasp.register.rst", "_autosummary/poli.objective_repository.rdkit_logp.rst", "_autosummary/poli.objective_repository.rdkit_logp.information.rst", "_autosummary/poli.objective_repository.rdkit_logp.register.rst", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox.rst", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory.rst", "_autosummary/poli.objective_repository.rdkit_qed.rst", "_autosummary/poli.objective_repository.rdkit_qed.information.rst", "_autosummary/poli.objective_repository.rdkit_qed.register.rst", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox.rst", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory.rst", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.rst", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information.rst", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register.rst", "_autosummary/poli.objective_repository.rmf_landscape.rst", "_autosummary/poli.objective_repository.rmf_landscape.information.rst", "_autosummary/poli.objective_repository.rmf_landscape.isolated_function.rst", "_autosummary/poli.objective_repository.rmf_landscape.register.rst", "_autosummary/poli.objective_repository.sa_tdc.rst", "_autosummary/poli.objective_repository.sa_tdc.information.rst", "_autosummary/poli.objective_repository.sa_tdc.isolated_function.rst", "_autosummary/poli.objective_repository.sa_tdc.register.rst", "_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox.rst", "_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory.rst", "_autosummary/poli.objective_repository.scaffold_hop.rst", "_autosummary/poli.objective_repository.scaffold_hop.information.rst", "_autosummary/poli.objective_repository.scaffold_hop.register.rst", "_autosummary/poli.objective_repository.sitagliptin_mpo.rst", "_autosummary/poli.objective_repository.sitagliptin_mpo.information.rst", "_autosummary/poli.objective_repository.sitagliptin_mpo.register.rst", "_autosummary/poli.objective_repository.super_mario_bros.rst", "_autosummary/poli.objective_repository.super_mario_bros.information.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized.rst", "_autosummary/poli.objective_repository.super_mario_bros.model.rst", "_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario.rst", "_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model.rst", "_autosummary/poli.objective_repository.super_mario_bros.register.rst", "_autosummary/poli.objective_repository.thiothixene_rediscovery.rst", "_autosummary/poli.objective_repository.thiothixene_rediscovery.information.rst", "_autosummary/poli.objective_repository.thiothixene_rediscovery.register.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.information.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.register.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem.rst", "_autosummary/poli.objective_repository.troglitazone_rediscovery.rst", "_autosummary/poli.objective_repository.troglitazone_rediscovery.information.rst", "_autosummary/poli.objective_repository.troglitazone_rediscovery.register.rst", "_autosummary/poli.objective_repository.valsartan_smarts.rst", "_autosummary/poli.objective_repository.valsartan_smarts.information.rst", "_autosummary/poli.objective_repository.valsartan_smarts.register.rst", "_autosummary/poli.objective_repository.white_noise.rst", "_autosummary/poli.objective_repository.white_noise.register.rst", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox.rst", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory.rst", "_autosummary/poli.objective_repository.zaleplon_mpo.rst", "_autosummary/poli.objective_repository.zaleplon_mpo.information.rst", "_autosummary/poli.objective_repository.zaleplon_mpo.register.rst", "_autosummary/poli.registered_objectives.rst", "_autosummary/poli.tests.rst", "_autosummary/poli.tests.benchmarks.rst", "_autosummary/poli.tests.benchmarks.test_benchmark_creation.rst", "_autosummary/poli.tests.conftest.rst", "_autosummary/poli.tests.docs_examples.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example.rst", "_autosummary/poli.tests.information.rst", "_autosummary/poli.tests.information.test_dynamic_information.rst", "_autosummary/poli.tests.registry.rst", "_autosummary/poli.tests.registry.basic_objectives.rst", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.rst", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha.rst", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise.rst", "_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion.rst", "_autosummary/poli.tests.registry.chemistry.rst", "_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives.rst", "_autosummary/poli.tests.registry.proteins.rst", "_autosummary/poli.tests.registry.proteins.test_foldx.rst", "_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo.rst", "_autosummary/poli.tests.registry.proteins.test_rasp.rst", "_autosummary/poli.tests.registry.test_basic_loop_without_create.rst", "_autosummary/poli.tests.registry.test_black_box_instancing.rst", "_autosummary/poli.tests.registry.test_force_isolation.rst", "_autosummary/poli.tests.registry.test_instancing_black_boxes_alone.rst", "_autosummary/poli.tests.registry.test_multi_objective_and_negative.rst", "_autosummary/poli.tests.registry.test_passing_array_of_strings.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems.rst", "_autosummary/poli.tests.registry.toy_discrete_problems.rst", "_autosummary/poli.tests.test_core_promises.rst", "_autosummary/poli.tests.test_minimal_working_example.rst", "_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example.rst", "_autosummary/poli.tests.test_seeding.rst", "_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise.rst", "_autosummary/poli.tests.util.rst", "_autosummary/poli.tests.util.test_foldx_interface.rst", "_autosummary/poli.tests.util.test_protein_utilities.rst", "_templates/custom-module-template.rst", "api.rst", "bibliography.md", "contributing/a_new_problem.md", "contributing/a_new_solver.md", "getting_started/getting_started.md", "index.md", "understanding_foldx/00-installing-foldx.md", "understanding_foldx/01-single-mutation-using-foldx/index.ipynb", "using_poli/objective_repository/RaSP.md", "using_poli/objective_repository/albuterol_similarity.md", "using_poli/objective_repository/all_objectives.md", "using_poli/objective_repository/aloha.md", "using_poli/objective_repository/amlodipine_mpo.md", "using_poli/objective_repository/celecoxib_rediscovery.md", "using_poli/objective_repository/deco_hop.md", "using_poli/objective_repository/dockstring.md", "using_poli/objective_repository/drd2_docking.md", "using_poli/objective_repository/drd3_docking.md", "using_poli/objective_repository/ehrlich_functions.md", "using_poli/objective_repository/fexofenadine_mpo.md", "using_poli/objective_repository/foldx_rfp_lambo.md", "using_poli/objective_repository/foldx_sasa.md", "using_poli/objective_repository/foldx_stability.md", "using_poli/objective_repository/gsk3_beta.md", "using_poli/objective_repository/isomer_c7h8n2o2.md", "using_poli/objective_repository/isomer_c9h10n2o2pf2cl.md", "using_poli/objective_repository/jnk3.md", "using_poli/objective_repository/median_1.md", "using_poli/objective_repository/median_2.md", "using_poli/objective_repository/mestranol_similarity.md", "using_poli/objective_repository/osimetrinib_mpo.md", "using_poli/objective_repository/penalized_logp_lambo.md", "using_poli/objective_repository/ranolazine_mpo.md", "using_poli/objective_repository/rdkit_logp.md", "using_poli/objective_repository/rdkit_qed.md", "using_poli/objective_repository/sa_tdc.md", "using_poli/objective_repository/scaffold_hop.md", "using_poli/objective_repository/sitagliptin_mpo.md", "using_poli/objective_repository/super_mario_bros.md", "using_poli/objective_repository/template.md", "using_poli/objective_repository/thiothixene_rediscovery.md", "using_poli/objective_repository/toy_continuous_problems.md", "using_poli/objective_repository/troglitazone_rediscovery.md", "using_poli/objective_repository/valsartan_smarts.md", "using_poli/objective_repository/white_noise.md", "using_poli/objective_repository/zaleplon_mpo.md", "using_poli/observers/registering_an_observer.md", "using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability.ipynb", "using_poli/the_basics/defining_a_problem_solver.md", "using_poli/the_basics/defining_an_observer.ipynb", "using_poli/the_basics/diving_deeper.md", "using_poli/the_basics/intro_to_poli.ipynb", "using_poli/the_basics/isolation.ipynb", "using_poli_baselines/alebo.md", "using_poli_baselines/baxus.md", "using_poli_baselines/bayesian_optimization.md", "using_poli_baselines/bounce.md", "using_poli_baselines/cma_es.md", "using_poli_baselines/graph_ga.md", "using_poli_baselines/hvarfners_vanilla_bo.md", "using_poli_baselines/latent_space_bo.md", "using_poli_baselines/line_bayesian_optimization.md", "using_poli_baselines/nsga_2.md", "using_poli_baselines/probrep.md", "using_poli_baselines/random_mutations.md", "using_poli_baselines/saasbo.md", "using_poli_baselines/template.md", "using_poli_baselines/turbo.md"], "titles": ["poli", "poli.core", "poli.core.abstract_benchmark", "poli.core.abstract_black_box", "poli.core.abstract_black_box.AbstractBlackBox", "poli.core.abstract_black_box.NegativeBlackBox", "poli.core.abstract_isolated_function", "poli.core.abstract_problem_factory", "poli.core.abstract_problem_factory.AbstractProblemFactory", "poli.core.abstract_problem_factory.MetaProblemFactory", "poli.core.benchmark_information", "poli.core.black_box_information", "poli.core.chemistry", "poli.core.chemistry.tdc_black_box", "poli.core.chemistry.tdc_black_box.TDCBlackBox", "poli.core.chemistry.tdc_isolated_function", "poli.core.exceptions", "poli.core.exceptions.BudgetExhaustedException", "poli.core.exceptions.PoliException", "poli.core.multi_objective_black_box", "poli.core.multi_objective_black_box.MultiObjectiveBlackBox", "poli.core.problem", "poli.core.problem_setup_information", "poli.core.problem_setup_information.ProblemSetupInformation", "poli.core.proteins", "poli.core.proteins.foldx_black_box", "poli.core.proteins.foldx_black_box.FoldxBlackBox", "poli.core.proteins.foldx_isolated_function", "poli.core.registry", "poli.core.registry.delete_observer_run_script", "poli.core.registry.delete_problem", "poli.core.registry.get_problem_factories", "poli.core.registry.get_problems", "poli.core.registry.register_problem", "poli.core.registry.register_problem_from_repository", "poli.core.registry.set_observer", "poli.core.registry.set_observer_run_script", "poli.core.util", "poli.core.util.abstract_observer", "poli.core.util.abstract_observer.AbstractObserver", "poli.core.util.algorithm_observer_wrapper", "poli.core.util.alignment", "poli.core.util.alignment.is_aligned", "poli.core.util.batch", "poli.core.util.batch.batch_input", "poli.core.util.batch.batch_input.batched", "poli.core.util.chemistry", "poli.core.util.chemistry.string_to_molecule", "poli.core.util.chemistry.string_to_molecule.selfies_to_molecules", "poli.core.util.chemistry.string_to_molecule.smiles_to_molecules", "poli.core.util.chemistry.string_to_molecule.strings_to_molecules", "poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles", "poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies", "poli.core.util.default_observer", "poli.core.util.external_observer", "poli.core.util.external_observer.ExternalObserver", "poli.core.util.files", "poli.core.util.files.download_files_from_github", "poli.core.util.files.download_files_from_github.download_file_from_github_repository", "poli.core.util.files.download_files_from_github.get_sha_for_tag", "poli.core.util.files.integrity", "poli.core.util.files.integrity.compute_md5_from_filepath", "poli.core.util.inter_process_communication", "poli.core.util.inter_process_communication.process_wrapper", "poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper", "poli.core.util.inter_process_communication.process_wrapper.get_connection", "poli.core.util.isolation", "poli.core.util.isolation.external_black_box", "poli.core.util.isolation.external_function", "poli.core.util.isolation.instancing", "poli.core.util.isolation.isolated_black_box", "poli.core.util.multi_observer", "poli.core.util.objective_management", "poli.core.util.objective_management.make_run_script", "poli.core.util.objective_management.make_run_script.make_observer_script", "poli.core.util.objective_management.make_run_script.make_run_script", "poli.core.util.observer_wrapper", "poli.core.util.observer_wrapper.start_observer_process", "poli.core.util.proteins", "poli.core.util.proteins.defaults", "poli.core.util.proteins.foldx", "poli.core.util.proteins.foldx.FoldxInterface", "poli.core.util.proteins.mutations", "poli.core.util.proteins.mutations.edits_between_strings", "poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant", "poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant", "poli.core.util.proteins.pdb_parsing", "poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings", "poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues", "poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure", "poli.core.util.proteins.rasp", "poli.core.util.proteins.rasp.inner_rasp", "poli.core.util.proteins.rasp.inner_rasp.PrismData", "poli.core.util.proteins.rasp.inner_rasp.cavity_model", "poli.core.util.proteins.rasp.inner_rasp.helpers", "poli.core.util.proteins.rasp.inner_rasp.run_pipeline", "poli.core.util.proteins.rasp.inner_rasp.visualization", "poli.core.util.proteins.rasp.load_models", "poli.core.util.proteins.rasp.rasp_interface", "poli.core.util.seeding", "poli.core.util.seeding.seeding", "poli.core.util.seeding.seeding.seed_numpy", "poli.core.util.seeding.seeding.seed_python", "poli.objective", "poli.objective.dynamically_instantiate", "poli.objective.parse_factory_kwargs", "poli.objective.run", "poli.objective_factory", "poli.objective_factory.ExternalBlackBox", "poli.objective_factory.create", "poli.objective_factory.load_config", "poli.objective_factory.start", "poli.objective_repository", "poli.objective_repository.albuterol_similarity", "poli.objective_repository.albuterol_similarity.information", "poli.objective_repository.albuterol_similarity.register", "poli.objective_repository.aloha", "poli.objective_repository.aloha.register", "poli.objective_repository.aloha.register.AlohaBlackBox", "poli.objective_repository.aloha.register.AlohaProblemFactory", "poli.objective_repository.amlodipine_mpo", "poli.objective_repository.amlodipine_mpo.information", "poli.objective_repository.amlodipine_mpo.register", "poli.objective_repository.celecoxib_rediscovery", "poli.objective_repository.celecoxib_rediscovery.information", "poli.objective_repository.celecoxib_rediscovery.register", "poli.objective_repository.deco_hop", "poli.objective_repository.deco_hop.information", "poli.objective_repository.deco_hop.register", "poli.objective_repository.dockstring", "poli.objective_repository.dockstring.information", "poli.objective_repository.dockstring.isolated_function", "poli.objective_repository.dockstring.register", "poli.objective_repository.dockstring.register.DockstringBlackBox", "poli.objective_repository.dockstring.register.DockstringProblemFactory", "poli.objective_repository.drd2_docking", "poli.objective_repository.drd2_docking.information", "poli.objective_repository.drd2_docking.register", "poli.objective_repository.drd3_docking", "poli.objective_repository.drd3_docking.information", "poli.objective_repository.drd3_docking.isolated_function", "poli.objective_repository.drd3_docking.register", "poli.objective_repository.drd3_docking.register.DRD3BlackBox", "poli.objective_repository.drd3_docking.register.DRD3ProblemFactory", "poli.objective_repository.ehrlich", "poli.objective_repository.ehrlich.information", "poli.objective_repository.ehrlich.register", "poli.objective_repository.fexofenadine_mpo", "poli.objective_repository.fexofenadine_mpo.information", "poli.objective_repository.fexofenadine_mpo.register", "poli.objective_repository.foldx_rfp_lambo", "poli.objective_repository.foldx_rfp_lambo.information", "poli.objective_repository.foldx_rfp_lambo.isolated_function", "poli.objective_repository.foldx_rfp_lambo.register", "poli.objective_repository.foldx_rfp_lambo.register.Config", "poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper", "poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory", "poli.objective_repository.foldx_rfp_lambo.register.get_config", "poli.objective_repository.foldx_sasa", "poli.objective_repository.foldx_sasa.foldx_utils", "poli.objective_repository.foldx_sasa.information", "poli.objective_repository.foldx_sasa.isolated_function", "poli.objective_repository.foldx_sasa.register", "poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox", "poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory", "poli.objective_repository.foldx_stability", "poli.objective_repository.foldx_stability.foldx_utils", "poli.objective_repository.foldx_stability.information", "poli.objective_repository.foldx_stability.isolated_function", "poli.objective_repository.foldx_stability.register", "poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox", "poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory", "poli.objective_repository.foldx_stability_and_sasa", "poli.objective_repository.foldx_stability_and_sasa.information", "poli.objective_repository.foldx_stability_and_sasa.isolated_function", "poli.objective_repository.foldx_stability_and_sasa.register", "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox", "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory", "poli.objective_repository.gfp_cbas", "poli.objective_repository.gfp_cbas.abstract_vae_wrapper", "poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data", "poli.objective_repository.gfp_cbas.cbas_wrapper", "poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper", "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder", "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder", "poli.objective_repository.gfp_cbas.gfp_gp", "poli.objective_repository.gfp_cbas.information", "poli.objective_repository.gfp_cbas.isolated_function", "poli.objective_repository.gfp_cbas.make_vae", "poli.objective_repository.gfp_cbas.make_vae.BaseVAE", "poli.objective_repository.gfp_cbas.make_vae.SimpleVAE", "poli.objective_repository.gfp_cbas.make_vae.build_vae", "poli.objective_repository.gfp_cbas.make_vae.identity_loss", "poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy", "poli.objective_repository.gfp_cbas.register", "poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox", "poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory", "poli.objective_repository.gfp_select", "poli.objective_repository.gfp_select.information", "poli.objective_repository.gfp_select.isolated_function", "poli.objective_repository.gfp_select.register", "poli.objective_repository.gfp_select.register.GFPBlackBox", "poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory", "poli.objective_repository.gsk3_beta", "poli.objective_repository.gsk3_beta.information", "poli.objective_repository.gsk3_beta.register", "poli.objective_repository.isomer_c7h8n2o2", "poli.objective_repository.isomer_c7h8n2o2.information", "poli.objective_repository.isomer_c7h8n2o2.register", "poli.objective_repository.isomer_c9h10n2o2pf2cl", "poli.objective_repository.isomer_c9h10n2o2pf2cl.information", "poli.objective_repository.isomer_c9h10n2o2pf2cl.register", "poli.objective_repository.jnk3", "poli.objective_repository.jnk3.information", "poli.objective_repository.jnk3.register", "poli.objective_repository.median_1", "poli.objective_repository.median_1.information", "poli.objective_repository.median_1.register", "poli.objective_repository.median_2", "poli.objective_repository.median_2.information", "poli.objective_repository.median_2.register", "poli.objective_repository.mestranol_similarity", "poli.objective_repository.mestranol_similarity.information", "poli.objective_repository.mestranol_similarity.register", "poli.objective_repository.osimetrinib_mpo", "poli.objective_repository.osimetrinib_mpo.information", "poli.objective_repository.osimetrinib_mpo.register", "poli.objective_repository.penalized_logp_lambo", "poli.objective_repository.penalized_logp_lambo.information", "poli.objective_repository.penalized_logp_lambo.isolated_function", "poli.objective_repository.penalized_logp_lambo.register", "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox", "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory", "poli.objective_repository.perindopril_mpo", "poli.objective_repository.perindopril_mpo.information", "poli.objective_repository.perindopril_mpo.register", "poli.objective_repository.ranolazine_mpo", "poli.objective_repository.ranolazine_mpo.information", "poli.objective_repository.ranolazine_mpo.register", "poli.objective_repository.rasp", "poli.objective_repository.rasp.information", "poli.objective_repository.rasp.isolated_function", "poli.objective_repository.rasp.register", "poli.objective_repository.rdkit_logp", "poli.objective_repository.rdkit_logp.information", "poli.objective_repository.rdkit_logp.register", "poli.objective_repository.rdkit_logp.register.LogPBlackBox", "poli.objective_repository.rdkit_logp.register.LogPProblemFactory", "poli.objective_repository.rdkit_qed", "poli.objective_repository.rdkit_qed.information", "poli.objective_repository.rdkit_qed.register", "poli.objective_repository.rdkit_qed.register.QEDBlackBox", "poli.objective_repository.rdkit_qed.register.QEDProblemFactory", "poli.objective_repository.rfp_foldx_stability_and_sasa", "poli.objective_repository.rfp_foldx_stability_and_sasa.information", "poli.objective_repository.rfp_foldx_stability_and_sasa.register", "poli.objective_repository.rmf_landscape", "poli.objective_repository.rmf_landscape.information", "poli.objective_repository.rmf_landscape.isolated_function", "poli.objective_repository.rmf_landscape.register", "poli.objective_repository.sa_tdc", "poli.objective_repository.sa_tdc.information", "poli.objective_repository.sa_tdc.isolated_function", "poli.objective_repository.sa_tdc.register", "poli.objective_repository.sa_tdc.register.SABlackBox", "poli.objective_repository.sa_tdc.register.SAProblemFactory", "poli.objective_repository.scaffold_hop", "poli.objective_repository.scaffold_hop.information", "poli.objective_repository.scaffold_hop.register", "poli.objective_repository.sitagliptin_mpo", "poli.objective_repository.sitagliptin_mpo.information", "poli.objective_repository.sitagliptin_mpo.register", "poli.objective_repository.super_mario_bros", "poli.objective_repository.super_mario_bros.information", "poli.objective_repository.super_mario_bros.level_utils", "poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level", "poli.objective_repository.super_mario_bros.level_utils.clean_level", "poli.objective_repository.super_mario_bros.level_utils.level_to_array", "poli.objective_repository.super_mario_bros.level_utils.level_to_list", "poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot", "poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels", "poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level", "poli.objective_repository.super_mario_bros.level_utils.vectorized", "poli.objective_repository.super_mario_bros.model", "poli.objective_repository.super_mario_bros.model.VAEMario", "poli.objective_repository.super_mario_bros.model.load_example_model", "poli.objective_repository.super_mario_bros.register", "poli.objective_repository.thiothixene_rediscovery", "poli.objective_repository.thiothixene_rediscovery.information", "poli.objective_repository.thiothixene_rediscovery.register", "poli.objective_repository.toy_continuous_problem", "poli.objective_repository.toy_continuous_problem.definitions", "poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01", "poli.objective_repository.toy_continuous_problem.definitions.alpine_01", "poli.objective_repository.toy_continuous_problem.definitions.alpine_02", "poli.objective_repository.toy_continuous_problem.definitions.bent_cigar", "poli.objective_repository.toy_continuous_problem.definitions.brown", "poli.objective_repository.toy_continuous_problem.definitions.camelback_2d", "poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds", "poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture", "poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray", "poli.objective_repository.toy_continuous_problem.definitions.deb_01", "poli.objective_repository.toy_continuous_problem.definitions.deb_02", "poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring", "poli.objective_repository.toy_continuous_problem.definitions.easom", "poli.objective_repository.toy_continuous_problem.definitions.egg_holder", "poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere", "poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang", "poli.objective_repository.toy_continuous_problem.information", "poli.objective_repository.toy_continuous_problem.register", "poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox", "poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory", "poli.objective_repository.toy_continuous_problem.toy_continuous_problem", "poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem", "poli.objective_repository.troglitazone_rediscovery", "poli.objective_repository.troglitazone_rediscovery.information", "poli.objective_repository.troglitazone_rediscovery.register", "poli.objective_repository.valsartan_smarts", "poli.objective_repository.valsartan_smarts.information", "poli.objective_repository.valsartan_smarts.register", "poli.objective_repository.white_noise", "poli.objective_repository.white_noise.register", "poli.objective_repository.white_noise.register.WhiteNoiseBlackBox", "poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory", "poli.objective_repository.zaleplon_mpo", "poli.objective_repository.zaleplon_mpo.information", "poli.objective_repository.zaleplon_mpo.register", "poli.registered_objectives", "poli.tests", "poli.tests.benchmarks", "poli.tests.benchmarks.test_benchmark_creation", "poli.tests.conftest", "poli.tests.docs_examples", "poli.tests.docs_examples.test_objective_functions", "poli.tests.docs_examples.test_objective_functions.test_aloha_example", "poli.tests.docs_examples.test_objective_functions.test_logp_example", "poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings", "poli.tests.docs_examples.test_objective_functions.test_qed_example", "poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings", "poli.tests.docs_examples.test_objective_functions.test_white_noise_example", "poli.tests.information", "poli.tests.information.test_dynamic_information", "poli.tests.registry", "poli.tests.registry.basic_objectives", "poli.tests.registry.basic_objectives.test_basic_objectives", "poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha", "poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise", "poli.tests.registry.basic_objectives.test_budget_exhaustion", "poli.tests.registry.chemistry", "poli.tests.registry.chemistry.test_chemistry_objectives", "poli.tests.registry.proteins", "poli.tests.registry.proteins.test_foldx", "poli.tests.registry.proteins.test_foldx_rfp_lambo", "poli.tests.registry.proteins.test_rasp", "poli.tests.registry.test_basic_loop_without_create", "poli.tests.registry.test_black_box_instancing", "poli.tests.registry.test_force_isolation", "poli.tests.registry.test_instancing_black_boxes_alone", "poli.tests.registry.test_multi_objective_and_negative", "poli.tests.registry.test_passing_array_of_strings", "poli.tests.registry.toy_continuous_problems", "poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims", "poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions", "poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems", "poli.tests.registry.toy_discrete_problems", "poli.tests.test_core_promises", "poli.tests.test_minimal_working_example", "poli.tests.test_minimal_working_example.test_minimal_working_example", "poli.tests.test_seeding", "poli.tests.test_seeding.test_seeding_in_white_noise", "poli.tests.util", "poli.tests.util.test_foldx_interface", "poli.tests.util.test_protein_utilities", "<no title>", "API documentation for poli", "References", "Adding a new black box to the repository", "Adding a new optimizer to poli-baselines", "Getting started", "poli \ud83e\uddea: a library of discrete objective functions", "Installing foldx", "Computing the energy of a protein and a single mutation", "Rapid Stability Predictions", "Albuterol Similarity (using TDC)", "All objective functions", "Aloha objective function", "Amlodipine MPO (using TDC)", "Celecoxib Rediscovery (using TDC)", "Deco Hop (using TDC)", "dockstring", "DRD2 Docking (using TDC)", "DRD3 docking (using TDC)", "Ehrlich functions", "Fexofenadine MPO (using TDC)", "Protein (RFP) stability and SASA (using foldx,lambo)", "Protein solvent accessibility (using foldx)", "Protein stability (using foldx)", "GSK3\u03b2 (using TDC)", "Isomer C7H8N2O2 (using TDC)", "Isomer C9H10N2O2PF2Cl (using TDC)", "c-Jun N-terminal Kinases-3 (using TDC)", "Median 1 (using TDC)", "Median 2 (using TDC)", "Mestranol Similarity (using TDC)", "Osimetrinib MPO (using TDC)", "Penalized logP (using lambo)", "Ranolazine MPO (using TDC)", "Log-solubility (logP)", "Quantitative Estimate of Druglikeness (QED)", "Synthetic Accessibility (using TDC)", "Scaffold Hop (using TDC)", "Sitagliptin MPO (using TDC)", "Optimizing jumps in Super Mario Bros", "Objective function name", "Thiothixene Rediscovery (using TDC)", "Toy continuous objective functions", "Troglitazone Rediscovery (using TDC)", "Valsartan SMARTS (using TDC)", "White Noise objective function", "Zaleplon MPO (using TDC)", "Registering and running observers in isolated processes", "Optimizing protein stability using random mutations", "Defining a problem solver in poli_baselines", "Defining an observer", "Diving deeper: how does poli work under the hood?", "What is poli?", "Isolating black box objective functions", "Adaptive Linear Embedding Bayesian Optimization (ALEBO)", "Adaptively expanding subspaces (BAxUS)", "Bayesian Optimization", "Bounce", "CMA-ES", "Graph Genetic Algorithms", "Hvarfner\u2019s Vanilla Bayesian Optimization", "Latent Space Bayesian Optimization", "Line Bayesian Optimization", "Discrete NSGA-2", "Probabilistic Reparametrization", "Random mutations", "Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)", "Template: optimization algorithm", "Trust Region Bayesian Optimization (Turbo)"], "terms": {"librari": [0, 39, 45, 306, 396, 438, 440, 441], "discret": [0, 21, 117, 118, 119, 146, 179, 390, 391, 392, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 442, 443, 444, 445, 448, 450, 452, 454, 456], "black": [0, 3, 4, 5, 6, 11, 12, 13, 14, 19, 20, 21, 24, 25, 26, 46, 78, 109, 111, 112, 117, 118, 119, 132, 133, 142, 146, 152, 153, 158, 162, 163, 165, 169, 170, 172, 175, 176, 210, 220, 246, 256, 257, 260, 261, 265, 266, 268, 270, 279, 325, 336, 337, 371, 392, 395, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 437, 438, 440, 444, 451], "box": [0, 3, 4, 5, 6, 11, 12, 13, 14, 19, 20, 21, 24, 25, 26, 46, 78, 109, 111, 112, 117, 118, 119, 132, 133, 142, 146, 152, 153, 158, 162, 163, 165, 169, 170, 172, 175, 176, 210, 220, 246, 256, 257, 260, 261, 265, 266, 268, 270, 279, 325, 336, 337, 371, 392, 395, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 437, 438, 440, 444, 451], "object": [0, 3, 4, 5, 6, 14, 19, 20, 25, 26, 39, 55, 59, 64, 65, 74, 81, 88, 89, 107, 109, 110, 111, 112, 116, 117, 118, 129, 132, 133, 138, 142, 152, 153, 162, 163, 165, 169, 170, 175, 176, 210, 220, 229, 246, 260, 265, 267, 270, 277, 278, 279, 301, 306, 322, 324, 325, 328, 336, 369, 371, 376, 390, 391, 392, 393, 397, 398, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 431, 432, 434, 437, 438, 442, 443, 444, 445, 448, 450, 451, 452, 454, 456], "function": [0, 3, 4, 5, 6, 14, 15, 19, 20, 21, 28, 39, 42, 43, 44, 45, 47, 51, 52, 57, 58, 60, 62, 63, 65, 69, 73, 76, 77, 82, 85, 86, 100, 107, 109, 111, 112, 116, 117, 118, 129, 132, 133, 138, 142, 146, 152, 153, 158, 163, 165, 170, 176, 181, 203, 210, 244, 245, 246, 260, 261, 265, 266, 267, 279, 289, 301, 305, 306, 322, 324, 325, 327, 328, 336, 337, 346, 356, 359, 369, 371, 373, 376, 380, 383, 390, 391, 392, 393, 396, 397, 398, 401, 402, 403, 404, 405, 406, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434, 437, 438, 444, 450, 451], "modul": [0, 1, 3, 6, 7, 12, 24, 25, 28, 37, 41, 43, 44, 46, 56, 57, 60, 62, 63, 66, 72, 73, 78, 79, 80, 82, 86, 93, 99, 112, 113, 116, 120, 123, 126, 129, 132, 135, 138, 144, 146, 147, 150, 158, 165, 172, 178, 198, 200, 212, 218, 221, 224, 227, 230, 233, 236, 239, 242, 244, 245, 248, 251, 254, 256, 257, 258, 263, 268, 271, 275, 281, 284, 287, 302, 305, 329, 332, 335, 339, 343, 344, 355, 357, 358, 363, 365, 369, 371, 375, 379, 383, 385, 388], "class": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 18, 19, 20, 21, 25, 26, 27, 38, 39, 40, 53, 54, 55, 63, 64, 68, 70, 80, 81, 115, 117, 118, 119, 122, 125, 128, 131, 132, 133, 134, 137, 141, 142, 143, 146, 149, 152, 153, 161, 162, 163, 164, 168, 169, 170, 171, 174, 175, 176, 177, 179, 180, 196, 197, 198, 199, 200, 202, 203, 204, 205, 209, 210, 211, 214, 215, 217, 220, 223, 226, 229, 232, 235, 238, 241, 244, 245, 246, 247, 250, 253, 256, 257, 260, 261, 262, 265, 266, 267, 270, 273, 274, 277, 278, 279, 280, 283, 286, 301, 304, 324, 325, 326, 327, 328, 331, 334, 336, 337, 338, 341, 391, 392, 407, 437, 438], "util": [1, 28, 200, 289, 391, 438, 441, 442, 444, 448, 454], "insid": [1, 6, 16, 112, 138, 391, 393, 394, 396, 397, 406, 427, 430, 436, 440, 441], "thi": [3, 5, 6, 7, 8, 11, 15, 19, 20, 21, 25, 28, 39, 44, 45, 51, 52, 57, 58, 60, 64, 65, 73, 77, 79, 80, 81, 82, 85, 86, 109, 111, 115, 117, 122, 125, 128, 132, 137, 138, 143, 146, 149, 162, 169, 175, 196, 200, 220, 223, 226, 229, 232, 235, 238, 241, 244, 245, 250, 253, 256, 257, 260, 265, 270, 283, 286, 304, 306, 322, 324, 325, 331, 334, 336, 341, 369, 371, 376, 380, 383, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "implement": [3, 5, 6, 7, 11, 12, 13, 15, 19, 20, 21, 24, 25, 44, 80, 115, 118, 122, 125, 128, 132, 133, 137, 141, 146, 149, 163, 170, 176, 179, 196, 204, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 256, 257, 274, 277, 278, 279, 283, 286, 304, 325, 331, 334, 341, 391, 392, 394, 399, 404, 407, 409, 415, 420, 430, 436, 437, 440, 441, 442, 443, 444, 445, 446, 448, 451, 452, 454, 456], "abstract": [3, 4, 6, 7, 8, 13, 14, 21, 38, 39, 390, 391, 436, 442, 456], "from": [3, 26, 45, 51, 52, 56, 57, 58, 59, 60, 61, 80, 81, 85, 93, 111, 115, 122, 125, 128, 138, 149, 163, 170, 176, 182, 187, 190, 205, 223, 226, 232, 235, 238, 241, 250, 253, 256, 257, 283, 286, 292, 295, 304, 306, 312, 321, 331, 334, 341, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "which": [3, 4, 6, 9, 14, 21, 26, 54, 61, 81, 85, 89, 110, 132, 142, 246, 265, 267, 279, 324, 325, 337, 391, 392, 396, 397, 399, 406, 407, 409, 424, 427, 430, 436, 437, 438, 440, 441, 444, 448, 454], "all": [3, 13, 107, 109, 112, 117, 118, 119, 138, 196, 306, 337, 391, 392, 393, 396, 397, 400, 407, 436, 437, 440, 441], "should": [3, 64, 138, 146, 391, 393, 395, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 430, 431, 432, 433, 434, 436, 437, 438, 441], "inherit": [3, 20, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 392, 436, 437, 438], "info": [26, 142, 337, 392, 436, 437, 438, 440, 445, 451, 452], "problemsetupinform": [26, 39, 337, 409, 438], "batch_siz": [4, 5, 14, 20, 26, 109, 118, 133, 142, 163, 170, 176, 192, 210, 246, 261, 266, 279, 325, 337, 391, 407, 451], "option": [4, 5, 14, 20, 26, 48, 50, 51, 52, 55, 58, 61, 74, 81, 83, 84, 87, 88, 89, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 328, 337, 392, 407], "int": [4, 5, 14, 20, 26, 39, 45, 65, 77, 83, 84, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 197, 210, 246, 261, 266, 279, 290, 291, 294, 325, 328, 337, 391, 392, 407, 437, 438, 440, 445, 452], "none": [4, 5, 14, 20, 26, 39, 51, 52, 55, 58, 74, 81, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 191, 193, 195, 210, 211, 246, 261, 266, 279, 325, 328, 337, 391, 392, 398, 400, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 438], "parallel": [4, 5, 14, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 407], "bool": [4, 5, 14, 26, 48, 49, 50, 51, 52, 58, 81, 83, 84, 87, 88, 89, 109, 111, 118, 133, 142, 163, 170, 176, 188, 210, 246, 261, 266, 279, 322, 325, 337, 391, 407], "fals": [4, 5, 14, 26, 49, 50, 51, 52, 58, 81, 84, 87, 88, 89, 109, 111, 118, 133, 142, 163, 170, 176, 187, 188, 194, 210, 246, 261, 266, 279, 295, 325, 337, 391, 397, 407, 427, 433, 438, 440], "num_work": [4, 5, 14, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 407], "evaluation_budget": [4, 5, 14, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 407], "inf": [4, 5, 13, 14, 26, 109, 115, 118, 122, 125, 128, 133, 142, 149, 163, 170, 176, 210, 223, 226, 232, 235, 238, 241, 246, 250, 253, 261, 266, 279, 283, 286, 304, 325, 331, 334, 337, 341, 391, 407, 433, 440], "base": [4, 8, 18, 39, 64, 138, 204, 390, 393, 394, 396, 399, 424, 442, 443, 445, 448, 451, 452, 454, 456], "optim": [4, 6, 13, 21, 39, 80, 125, 146, 150, 242, 244, 245, 304, 305, 306, 324, 327, 331, 376, 390, 395, 396, 399, 402, 405, 407, 409, 410, 411, 412, 413, 414, 415, 416, 417, 420, 429, 430, 431, 437, 438, 443, 445, 451, 452, 453], "problem": [4, 7, 8, 11, 13, 14, 26, 28, 42, 72, 73, 109, 117, 118, 119, 133, 134, 143, 164, 177, 260, 265, 267, 268, 280, 287, 306, 324, 325, 335, 336, 337, 376, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 431, 432, 433, 434, 438, 440, 441, 443, 445, 451, 452, 453], "paramet": [4, 5, 8, 14, 20, 26, 45, 48, 49, 50, 51, 52, 55, 58, 59, 61, 64, 65, 74, 77, 81, 82, 83, 84, 85, 87, 88, 89, 101, 102, 109, 111, 118, 119, 133, 134, 142, 163, 164, 170, 176, 177, 210, 246, 261, 266, 267, 279, 280, 325, 337, 392, 407], "The": [4, 5, 11, 14, 20, 21, 25, 26, 39, 45, 55, 58, 59, 61, 64, 65, 74, 77, 80, 81, 83, 84, 85, 87, 88, 89, 109, 110, 111, 116, 117, 118, 119, 133, 138, 142, 162, 163, 169, 170, 175, 176, 204, 210, 242, 246, 261, 266, 267, 270, 271, 274, 279, 301, 320, 321, 324, 325, 336, 337, 390, 392, 394, 396, 397, 399, 404, 405, 407, 409, 410, 411, 412, 427, 436, 437, 441, 442, 443, 448, 451, 454, 456], "setup": [21, 26, 55, 77, 143, 337, 409], "inform": [4, 11, 21, 26, 39, 55, 77, 109, 111, 132, 133, 134, 143, 256, 257, 328, 337, 390, 396, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 436, 438, 440, 442, 443, 452, 456], "provid": [20, 55, 107, 115, 143, 170, 238, 391, 394, 395, 396, 405, 407, 427, 438, 440, 441, 442, 445, 452], "detail": [82, 146, 396, 407, 436, 440], "about": [109, 111, 391, 394, 395, 399, 436, 440], "batch": [4, 5, 14, 20, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 407], "size": [4, 5, 14, 20, 26, 45, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 407, 443, 446, 451], "evalu": [4, 5, 6, 14, 19, 20, 21, 26, 109, 111, 118, 133, 142, 146, 163, 170, 176, 210, 246, 261, 266, 267, 279, 325, 337, 392, 393, 407, 410, 411, 437, 438, 441], "default": [4, 5, 14, 20, 26, 53, 55, 58, 61, 81, 83, 84, 87, 88, 89, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 392, 398, 401, 402, 403, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 444, 450], "flag": [4, 5, 14, 26, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325], "indic": [4, 5, 14, 26, 118, 133, 142, 163, 170, 176, 182, 183, 210, 246, 261, 266, 279, 325, 392, 437], "whether": [4, 5, 11, 14, 21, 26, 58, 87, 88, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 371, 383, 391, 396, 397, 407, 422, 423, 427, 436, 438], "number": [4, 5, 14, 21, 26, 45, 65, 77, 99, 100, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 301, 325, 337, 392, 398, 399, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 437, 440, 448], "worker": [4, 5, 14, 26, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337], "us": [4, 5, 6, 9, 11, 14, 21, 26, 39, 40, 51, 52, 55, 58, 60, 64, 65, 79, 80, 81, 109, 111, 115, 117, 118, 122, 125, 128, 133, 137, 138, 141, 142, 149, 163, 169, 170, 172, 176, 186, 187, 188, 210, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 246, 250, 253, 256, 257, 258, 261, 263, 265, 266, 268, 271, 277, 278, 279, 283, 286, 304, 324, 325, 331, 334, 336, 341, 369, 376, 390, 391, 392, 395, 396, 397, 399, 400, 404, 407, 422, 423, 427, 430, 433, 435, 437, 438, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 454, 456], "half": [4, 5, 14, 109, 142, 163, 170, 176, 210, 246, 325, 337], "avail": [4, 5, 14, 109, 138, 142, 162, 163, 169, 170, 175, 176, 210, 246, 270, 325, 337, 391, 393, 396, 399, 409, 410, 411, 422, 423, 427, 430, 436, 440], "cpu": [4, 5, 14, 109, 142, 163, 170, 176, 210, 246, 325, 337], "maximum": [4, 5, 14, 21, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 392], "allow": [4, 5, 6, 9, 11, 14, 21, 25, 26, 109, 142, 162, 163, 169, 170, 175, 176, 210, 246, 260, 265, 270, 324, 325, 391, 392, 395, 396, 427, 430, 437, 440], "float": [4, 5, 14, 26, 142, 163, 170, 176, 210, 246, 261, 265, 266, 279, 318, 325, 337, 391, 394, 407], "type": [4, 14, 20, 26, 48, 49, 50, 51, 52, 59, 64, 65, 74, 81, 83, 84, 85, 87, 88, 89, 109, 110, 118, 133, 137, 142, 184, 189, 261, 266, 271, 274, 325, 391, 396, 405], "observ": [4, 6, 28, 37, 38, 39, 40, 53, 54, 55, 72, 73, 74, 76, 77, 109, 111, 187, 392, 394], "record": [4, 301], "dure": [4, 77, 391, 430], "abstractobserv": [4, 74, 438], "observer_info": 4, "given": [4, 20, 51, 52, 65, 74, 81, 84, 89, 132, 133, 134, 170, 184, 185, 186, 301, 392, 393, 397, 398, 401, 404, 407, 408, 413, 414, 418, 419, 421, 426, 427, 434, 437], "after": [4, 39, 138, 391, 392, 396, 406, 409, 436, 437], "initi": [4, 5, 14, 20, 21, 26, 39, 55, 64, 77, 81, 109, 111, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 392, 396, 407, 436, 437, 440, 451], "set_observ": [4, 435, 438], "set": [4, 39, 64, 89, 138, 186, 188, 194, 200, 261, 266, 391, 392, 404, 407, 424, 427, 437, 438, 440], "reset_evaluation_budget": 4, "reset": [4, 111], "budget": [4, 17, 21, 26, 111, 407, 440], "made": 4, "0": [4, 81, 83, 163, 170, 176, 206, 265, 271, 274, 295, 318, 392, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 437, 438, 440, 442, 443, 444, 445, 446, 448, 450, 452, 454, 456], "__call__": [4, 5, 6, 391], "x": [4, 5, 6, 20, 39, 55, 111, 118, 133, 137, 138, 170, 188, 193, 194, 261, 266, 307, 308, 309, 310, 311, 312, 313, 314, 316, 317, 318, 321, 322, 325, 337, 390, 391, 392, 393, 398, 400, 401, 402, 403, 404, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 444, 452], "context": [4, 6, 20, 39, 55, 111, 118, 133, 170, 261, 266, 325, 337, 391, 438], "input": [4, 20, 42, 44, 109, 118, 133, 170, 261, 266, 274, 325, 337, 391, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 437, 442, 443, 444, 448, 450, 451, 452, 454, 456], "_black_box": [4, 5, 6, 20, 118, 133, 170, 261, 266, 325, 337, 391], "method": [4, 5, 6, 8, 9, 14, 20, 26, 39, 55, 64, 81, 85, 89, 109, 118, 119, 133, 134, 142, 143, 163, 164, 170, 171, 176, 177, 180, 186, 197, 198, 199, 204, 205, 210, 211, 217, 246, 247, 261, 262, 266, 267, 279, 280, 325, 326, 328, 337, 338, 391, 392, 396, 409, 410, 411, 436, 437, 438, 440], "termin": [4, 77, 438], "__enter__": 4, "enter": 4, "manag": [4, 58, 111], "__exit__": 4, "exc_typ": 4, "exc_val": 4, "exc_tb": 4, "exit": 4, "__del__": 4, "destructor": 4, "__neg__": 4, "creat": [4, 8, 21, 26, 58, 64, 72, 73, 74, 107, 111, 119, 134, 143, 164, 177, 267, 280, 287, 369, 371, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 431, 432, 433, 434, 436, 438, 441, 442, 443, 445, 448, 451, 452, 453, 454, 455], "new": [4, 14, 142, 394, 396, 437, 440], "neg": [4, 208, 397, 404, 411], "origin": [4, 5, 81, 82, 85, 179, 321, 396, 442, 443, 448, 452, 454, 456], "one": [4, 191, 294, 390, 391, 392, 394, 396, 397, 399, 409, 436, 437, 441, 450], "__init__": [4, 5, 8, 9, 14, 20, 26, 39, 55, 64, 81, 118, 119, 133, 134, 142, 143, 163, 164, 170, 171, 176, 177, 180, 197, 198, 199, 204, 205, 210, 211, 217, 246, 247, 261, 262, 266, 267, 279, 280, 325, 326, 328, 337, 338, 392, 437, 438], "execut": [4, 5, 14, 60, 64, 74, 138, 142, 163, 170, 176, 210, 246, 279, 325, 395, 406], "we": [4, 5, 14, 19, 26, 79, 85, 109, 115, 122, 125, 128, 137, 138, 142, 149, 162, 163, 169, 170, 175, 176, 187, 210, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 246, 250, 253, 260, 261, 265, 266, 270, 283, 286, 304, 306, 320, 322, 324, 325, 331, 334, 341, 376, 380, 391, 392, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 454, 456], "f": [5, 25, 79, 80, 111, 162, 169, 175, 270, 391, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 441, 444, 446, 450, 451, 453, 455], "abstractblackbox": [5, 14, 20, 111, 142, 163, 170, 176, 210, 246, 325, 391, 392, 437, 438], "A": [5, 13, 14, 26, 40, 45, 48, 49, 50, 51, 52, 79, 81, 83, 84, 85, 87, 88, 111, 117, 118, 119, 138, 142, 146, 150, 158, 162, 163, 169, 170, 172, 175, 176, 246, 261, 266, 268, 270, 275, 279, 287, 305, 325, 327, 335, 337, 390, 393, 394, 396, 397, 399, 400, 405, 407, 410, 411, 412, 415, 424, 427, 430, 438, 442, 450, 452], "wrapper": [5, 15, 40, 138, 150, 179, 196, 260, 265, 275, 394, 399, 451], "negat": [5, 210], "If": [5, 20, 39, 45, 48, 49, 50, 51, 52, 55, 58, 59, 65, 77, 80, 81, 83, 84, 85, 89, 101, 102, 109, 111, 220, 322, 325, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 438, 440, 441, 442, 443, 445, 448, 450, 452, 454, 456], "you": [5, 6, 14, 81, 89, 115, 122, 125, 128, 137, 138, 142, 149, 220, 223, 226, 229, 232, 241, 250, 253, 261, 266, 279, 283, 286, 304, 306, 331, 334, 341, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 445, 448, 450, 452, 454, 456], "construct": [5, 205, 407], "maxim": [5, 128, 146, 301, 306, 321, 322, 392, 397, 407, 430], "minim": [5, 306, 391, 392, 399, 404, 437, 451], "latter": [5, 396], "onli": [5, 6, 111, 179, 187, 196, 315, 319, 320, 325, 392, 393, 396, 397, 404, 409, 410, 411, 430, 437], "differ": [5, 25, 83, 162, 169, 175, 270, 391, 392, 393, 396, 397, 437, 438, 441, 442, 443, 445, 448, 452, 454], "return": [5, 26, 48, 49, 50, 51, 52, 59, 61, 65, 74, 81, 83, 84, 85, 87, 88, 89, 109, 110, 111, 170, 184, 185, 186, 189, 191, 206, 207, 246, 260, 261, 265, 266, 267, 293, 335, 336, 337, 391, 392, 397, 400, 404, 407, 409, 410, 411, 422, 423, 427, 433, 436, 437], "instead": [5, 306, 392, 410, 411, 437, 448], "same": [5, 84, 85, 242, 244, 245, 246, 391, 393, 397, 416, 417], "factori": [7, 8, 25, 64, 107, 109, 111, 112, 116, 117, 119, 129, 132, 134, 143, 152, 153, 162, 164, 165, 169, 175, 177, 260, 265, 267, 270, 280, 301, 324, 336, 391, 394, 407], "defin": [8, 82, 268, 306, 376, 392, 430, 440, 441, 445, 452], "interfac": [8, 80, 107, 391, 394, 412, 415, 432, 441, 445, 448, 452], "instanc": [8, 14, 20, 119, 134, 142, 164, 177, 267, 280, 325, 391, 392, 393, 436, 441, 451], "get_setup_inform": 391, "specifi": [8, 14, 58, 59, 109, 119, 134, 142, 164, 177, 185, 190, 198, 204, 267, 279, 280, 324, 396, 422, 423, 442, 451], "metaclass": 9, "abstractproblemfactori": [9, 391], "overrid": 9, "__repr__": 9, "__str__": 9, "arg": [9, 198, 199, 204, 205, 391, 396], "kwarg": [9, 198, 199, 204, 205, 391], "contain": [6, 11, 12, 24, 28, 45, 60, 73, 79, 82, 83, 84, 86, 110, 182, 183, 200, 328, 380, 391, 393, 396, 407, 410, 411, 427], "relat": [12, 13, 24, 46, 78, 109, 395, 436], "around": [15, 40, 138, 150, 260, 265, 275, 394, 399, 451], "therapeut": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 394, 398, 399, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "data": [14, 15, 43, 58, 118, 133, 138, 187, 188, 194, 195, 200, 220, 229, 390, 394, 396, 398, 399, 401, 402, 403, 405, 406, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "common": [14, 15, 107, 390, 394, 396, 398, 399, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 451], "tdc": [13, 14, 15, 115, 122, 125, 128, 137, 138, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 275, 277, 278, 279, 283, 286, 304, 331, 334, 341, 394, 399], "oracl": [14, 15, 115, 122, 125, 128, 137, 141, 142, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 275, 277, 278, 279, 283, 286, 304, 331, 334, 341, 394, 398, 399, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "1": [13, 14, 15, 25, 45, 80, 83, 85, 111, 115, 122, 125, 128, 132, 133, 134, 137, 141, 146, 149, 150, 162, 163, 169, 170, 175, 176, 182, 183, 187, 194, 206, 210, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 246, 250, 253, 256, 257, 265, 270, 271, 274, 277, 278, 279, 283, 286, 290, 304, 306, 312, 321, 324, 328, 331, 334, 341, 390, 392, 393, 394, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 437, 438, 440, 442, 443, 444, 445, 446, 448, 450, 451, 452, 454, 456], "so": [85, 261, 266, 391, 392, 396, 409, 420, 437, 441], "far": [392, 437], "support": [369, 393, 394, 437, 441], "two": [65, 83, 393, 396, 430, 438, 441, 451], "drd3": [138, 141, 142, 143, 394, 399], "synthet": [275, 277, 278, 279, 280, 390, 394, 399], "access": [58, 81, 138, 158, 163, 164, 172, 176, 177, 268, 277, 278, 279, 280, 390, 391, 394, 396, 399, 406, 422, 423, 427, 430], "see": [51, 52, 82, 117, 138, 271, 306, 324, 327, 336, 392, 393, 396, 397, 409, 436, 440, 441], "document": [393, 394, 396, 413, 414, 426, 434, 436, 441], "our": [391, 392, 396, 397, 399, 404, 410, 411, 436, 437, 438, 440, 441, 444, 446, 448, 451], "more": [82, 163, 170, 176, 327, 328, 393, 396, 413, 414, 426, 434, 436, 440], "refer": [13, 14, 15, 25, 80, 115, 122, 125, 128, 132, 133, 134, 137, 138, 141, 146, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 274, 277, 278, 283, 286, 304, 331, 334, 341, 394, 397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434], "artifici": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 306, 331, 334, 341, 390, 427, 454], "intellig": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 454], "foundat": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "scienc": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 397], "huang": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "kexin": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "tianfan": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "fu": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "wenhao": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "gao": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 398, 399, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "yue": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "zhao": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "yusuf": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "roohani": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "jure": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "leskovec": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "connor": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "w": [13, 14, 15, 79, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 277, 278, 283, 286, 294, 304, 331, 334, 341, 390, 394, 396, 398, 401, 402, 403, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 438], "colei": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "cao": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "xiao": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "jimeng": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "sun": [13, 15, 220, 229, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "marinka": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "zitnik": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "natur": 15, "chemic": [15, 132, 133, 134, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "biologi": [15, 138, 162, 169, 175, 270, 390, 406], "18": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390], "10": [13, 14, 15, 45, 115, 122, 125, 128, 132, 133, 134, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 392, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 433, 434, 436, 442, 443, 444, 445, 446, 448, 450, 451, 452, 454, 456], "octob": 15, "2022": [13, 14, 15, 80, 115, 122, 125, 128, 132, 133, 134, 137, 141, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 395, 396, 399, 404, 405, 409, 410, 411, 412, 415, 420, 436, 443, 452], "1033": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "36": 15, "http": [13, 14, 15, 45, 57, 58, 80, 82, 115, 122, 125, 128, 132, 133, 134, 137, 138, 141, 146, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 306, 327, 328, 331, 334, 341, 390, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 440, 442, 443, 445, 448, 450, 452, 454, 456], "doi": [13, 14, 15, 115, 122, 125, 128, 132, 133, 134, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 448], "org": [13, 14, 15, 45, 80, 115, 122, 125, 128, 132, 133, 134, 137, 141, 146, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 306, 327, 328, 331, 334, 341, 390, 396, 397, 398, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 430, 431, 432, 434, 445, 448], "1038": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "s41589": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "022": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "01131": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "2": [13, 14, 15, 45, 80, 83, 115, 122, 125, 128, 137, 141, 149, 162, 169, 175, 182, 183, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 270, 271, 274, 277, 278, 283, 286, 304, 306, 322, 325, 328, 331, 334, 341, 390, 391, 393, 394, 396, 397, 398, 399, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 440, 442, 443, 444, 445, 448, 450, 452, 454, 456], "oracle_nam": [14, 142], "str": [14, 26, 48, 49, 50, 51, 52, 55, 58, 59, 61, 64, 65, 74, 77, 81, 83, 84, 85, 87, 88, 89, 109, 111, 133, 142, 163, 170, 176, 211, 292, 293, 325, 391, 396, 407, 433, 438, 445, 452], "from_smil": [142, 261, 266], "true": [48, 49, 50, 51, 52, 58, 81, 83, 84, 89, 109, 111, 142, 188, 205, 210, 246, 261, 266, 322, 391, 396, 410, 411, 433, 436, 438, 440], "kwargs_for_oracl": 14, "repres": [26, 65, 83, 88, 142, 204, 440], "It": [64, 65, 138, 391, 392, 393, 396, 404, 406, 437, 440, 442], "name": [11, 14, 15, 55, 58, 59, 77, 87, 88, 89, 109, 111, 133, 142, 325, 328, 391, 392, 393, 396, 397, 409, 433, 436, 438, 440, 443, 445, 452], "comput": [25, 61, 81, 83, 85, 118, 133, 138, 162, 163, 169, 170, 172, 175, 176, 242, 244, 245, 258, 261, 266, 268, 270, 306, 390, 393, 394, 395, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 441, 442, 443, 445, 448, 450, 452, 454, 456], "dock": [132, 133, 134, 137, 138, 141, 142, 143, 390, 394, 399, 404, 441], "score": [132, 133, 134, 163, 170, 176, 390, 394, 397, 399, 404, 405, 406, 410, 411, 420, 424, 441], "an": [6, 13, 14, 15, 21, 25, 39, 42, 45, 48, 49, 50, 51, 52, 54, 55, 58, 65, 76, 77, 80, 85, 109, 111, 162, 169, 175, 182, 183, 220, 229, 270, 294, 325, 391, 393, 394, 395, 396, 397, 404, 407, 409, 410, 411, 412, 415, 427, 428, 430, 432, 436, 440, 441, 442, 443, 444, 445, 446, 448, 451, 452, 454, 456], "process": [6, 39, 54, 55, 64, 65, 76, 77, 109, 111, 118, 133, 163, 169, 170, 176, 200, 261, 266, 390, 391, 396, 398, 401, 402, 403, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 440, 441, 442, 443, 444, 452, 454, 456], "multipl": [118, 133, 261, 266, 397], "infin": [14, 109, 118, 133, 142, 163, 170, 176, 261, 266, 279], "molecul": [14, 47, 48, 49, 50, 115, 132, 133, 134, 137, 142, 220, 229, 238, 246, 261, 266, 267, 279, 304, 331, 390, 393, 396, 404, 405, 406, 412, 415, 416, 417, 424, 440], "ar": [6, 21, 39, 80, 83, 85, 110, 138, 146, 188, 246, 261, 266, 267, 324, 376, 391, 392, 393, 395, 397, 399, 407, 409, 410, 411, 422, 423, 427, 428, 430, 436, 437, 438, 440, 441, 444, 448], "smile": [14, 49, 50, 51, 52, 115, 128, 133, 142, 238, 246, 260, 261, 265, 266, 279, 394, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 429, 431, 432, 434], "format": [64, 82, 85, 184], "represent": [14, 47, 50, 133, 142, 256, 257, 261, 266, 279, 390, 397, 441], "dict": [14, 64, 109, 111, 118, 133, 391], "addit": [55, 64, 74, 109, 111, 146, 397, 407], "keyword": [14, 55, 64, 109, 111, 391, 410, 411], "argument": [14, 39, 55, 64, 109, 111, 410, 411], "custom": 16, "packag": [16, 18, 51, 52, 57, 436, 440, 441, 443], "rais": [17, 20, 48, 49, 51, 52, 58, 59, 65, 80, 83, 84, 392, 395, 437], "when": [15, 17, 64, 109, 111, 115, 122, 125, 128, 137, 146, 149, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 391, 397, 407, 413, 414, 426, 434, 438, 440, 441], "exhaust": 17, "multi_object": 19, "version": [19, 55, 81, 138, 242, 265, 267, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 437, 438, 442, 443, 445, 448, 450, 451, 452, 454, 456], "mean": [19, 85, 186, 246, 391, 392, 420, 430, 446], "simpli": [19, 392, 393, 409, 437, 438], "concaten": [19, 20, 261, 266], "result": [19, 20, 81, 261, 266, 396, 438, 441], "individu": [19, 20, 82, 293, 396, 438, 441], "objective_funct": [20, 451], "list": [20, 26, 48, 49, 50, 51, 52, 74, 81, 82, 83, 84, 85, 87, 88, 163, 170, 176, 182, 196, 205, 291, 293, 325, 328, 391, 394, 396, 407, 410, 411, 438, 440, 445, 452], "multi": [20, 220, 229, 390, 401, 408, 412, 415, 419, 421, 426, 434, 451], "requir": [20, 26, 39, 57, 58, 138, 391, 392, 394, 396, 397, 427, 436, 437, 438, 440, 441], "valueerror": [20, 59, 84], "e": [6, 21, 58, 79, 85, 111, 118, 138, 146, 182, 183, 187, 256, 257, 261, 266, 267, 322, 337, 390, 391, 392, 393, 394, 396, 397, 399, 404, 407, 409, 410, 411, 433, 436, 437, 438, 442, 448, 452, 454], "g": [6, 21, 79, 85, 182, 183, 267, 274, 391, 392, 393, 394, 396, 399, 407, 410, 411, 433, 436, 437, 438, 454], "alphabet": [11, 26, 118, 133, 391, 392, 407, 409, 433, 436, 437, 438, 440, 445, 451, 452, 453, 455], "sequenc": [11, 80, 117, 118, 119, 146, 150, 182, 183, 184, 185, 189, 190, 191, 242, 244, 245, 390, 391, 392, 394, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 440, 442, 443, 445, 448, 450, 452, 454, 456], "length": [11, 45, 83, 84, 193, 391, 396, 407, 445, 452], "max_sequence_length": [391, 433, 438, 440], "align": [11, 390, 391, 394, 433, 438, 440], "log_transform_recommend": [391, 433, 438], "s": [11, 21, 26, 51, 52, 79, 80, 111, 138, 146, 163, 170, 176, 179, 256, 257, 260, 261, 265, 266, 267, 306, 320, 390, 393, 394, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 450, 451, 452, 454, 456], "longest": 11, "have": [6, 11, 45, 138, 146, 163, 170, 176, 306, 369, 391, 392, 393, 395, 396, 397, 404, 406, 407, 409, 410, 411, 420, 427, 428, 436, 437, 440, 441, 442, 443, 445, 448, 452, 454], "been": [306, 395], "charact": 11, "mai": [256, 257, 390, 397, 440, 443, 445, 450, 452], "appear": [393, 396], "recommend": [115, 122, 125, 128, 137, 138, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 391, 393, 394, 406, 409, 427, 446], "algorithm": [21, 39, 146, 324, 376, 390, 392, 396, 407, 430, 437, 438, 440, 444, 451], "log": [55, 208, 242, 258, 260, 261, 391, 392, 394, 399, 448], "transform": [47, 289, 294, 295, 391], "target": [118, 133], "foldx": [25, 26, 82, 85, 162, 163, 164, 165, 169, 170, 172, 175, 176, 177, 256, 257, 268, 270, 393, 394, 396, 399, 436, 441], "simul": [25, 26, 80, 81, 162, 169, 175, 270, 306, 391, 393, 427], "free": [25, 162, 169, 175, 270, 391, 392, 395, 396], "energi": [25, 81, 162, 169, 175, 270, 395, 411], "between": [25, 83, 85, 118, 162, 169, 175, 265, 270, 407, 413, 414, 422, 426, 434], "wildtyp": [25, 26, 84, 85, 162, 163, 169, 170, 175, 176, 256, 257, 270, 394, 397, 399, 410, 411], "mutat": [25, 26, 81, 162, 169, 175, 184, 270, 390, 392, 394, 397, 399, 410, 411, 437, 440, 451], "web": [25, 80, 162, 169, 175, 270, 409, 410, 411], "server": [25, 64, 65, 80, 162, 169, 175, 270, 409, 410, 411], "onlin": [25, 80, 162, 169, 175, 270, 409, 410, 411], "forc": [14, 25, 80, 142, 162, 169, 175, 270, 371, 409, 410, 411], "field": [25, 80, 162, 169, 175, 270, 409, 410, 411], "nucleic": [25, 80, 162, 169, 175, 270, 409, 410, 411], "acid": [25, 26, 79, 80, 162, 169, 175, 182, 183, 185, 190, 191, 270, 407, 409, 410, 411], "research": [25, 80, 162, 169, 175, 270, 390, 409, 410, 411], "schymkowitz": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "j": [13, 25, 80, 115, 122, 125, 128, 132, 133, 134, 149, 162, 169, 175, 223, 226, 232, 235, 238, 241, 250, 253, 270, 271, 274, 283, 286, 304, 331, 334, 341, 390, 404, 427, 438, 450, 456], "borg": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "stricher": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "ny": [25, 80, 162, 169, 175, 270, 409, 410, 411], "r": [25, 79, 80, 85, 146, 162, 169, 175, 270, 271, 274, 306, 390, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 438, 442, 443, 445, 448, 450, 452, 454, 456], "rousseau": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "serrano": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "l": [25, 79, 80, 111, 117, 118, 119, 162, 169, 175, 192, 197, 198, 199, 220, 229, 256, 257, 270, 390, 391, 392, 393, 397, 400, 407, 428, 430, 433, 437, 438, 440, 443, 445, 448], "2005": [25, 80, 162, 169, 175, 270, 409, 410, 411], "33": [25, 80, 162, 169, 175, 206, 270, 390, 396, 409, 410, 411, 412, 415, 442], "suppl_2": [25, 80, 162, 169, 175, 270], "w382": [25, 80, 162, 169, 175, 270, 409, 410, 411], "w388": [25, 80, 162, 169, 175, 270, 409, 410, 411], "wildtype_pdb_path": [26, 163, 170, 176, 397, 410, 411, 436], "union": [26, 74, 81, 84, 163, 170, 176], "path": [26, 58, 61, 74, 81, 84, 87, 88, 89, 138, 163, 170, 176, 195, 391, 396, 397, 409, 410, 411, 436, 438], "experiment_id": [26, 163, 170, 176, 438], "tmp_folder": [26, 163, 170, 176], "eager_repair": [26, 163, 170, 176, 410, 411], "verbos": [26, 58, 81, 87, 88, 89, 163, 170, 176], "pdb": [26, 81, 84, 85, 86, 87, 88, 89, 163, 169, 170, 176, 256, 257, 393, 397, 410, 411, 436, 441], "file": [26, 80, 81, 82, 84, 85, 86, 87, 88, 89, 110, 117, 138, 163, 169, 170, 176, 256, 257, 324, 336, 390, 391, 393, 395, 397, 409, 436, 438, 442, 443, 445, 448, 452, 454], "amino": [26, 79, 182, 183, 185, 190, 191, 407], "experi": [26, 163, 170, 176, 187, 306, 438], "id": [26, 82, 163, 170, 176, 291, 369, 390, 391, 396, 405, 412, 415, 438, 443], "temporari": [26, 163, 170, 176], "folder": [26, 58, 117, 138, 163, 170, 176, 324, 336, 391, 392, 393, 395, 438, 441], "eagerli": [26, 170], "repair": [26, 80, 81, 163, 170, 176, 436], "print": [26, 45, 58, 81, 87, 88, 89, 111, 163, 170, 176, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 451, 453, 455], "output": [26, 81, 87, 88, 89, 163, 170, 176, 391, 394, 396, 440, 441], "wildtype_residu": [26, 85], "residu": [26, 82, 84, 85, 87, 88, 396], "each": [26, 39, 45, 83, 85, 185, 190, 394, 396, 438, 440, 441, 446], "wildtype_amino_acid": 26, "wildtype_residue_str": [26, 85], "string": [14, 26, 47, 48, 49, 50, 51, 52, 64, 83, 84, 85, 87, 115, 133, 142, 183, 184, 193, 238, 260, 261, 265, 266, 279, 292, 293, 392, 394, 396, 400, 403, 405, 422, 423, 425, 427, 433, 437, 453, 455], "create_working_directori": 26, "work": [26, 45, 74, 81, 111, 138, 315, 319, 371, 383, 392, 393, 395, 396, 399, 404, 422, 423, 436, 437, 438, 440, 442, 443, 444, 448, 454, 456], "directori": [26, 74, 81, 395, 396, 397, 409, 410, 411, 438], "regist": [15, 28, 110, 138, 393, 407, 440], "observer_nam": [55, 77, 109, 111, 435], "delet": 438, "run": [6, 15, 21, 54, 64, 72, 73, 74, 81, 109, 111, 138, 170, 391, 392, 393, 395, 396, 437, 438, 440], "script": [6, 15, 64, 72, 73, 74, 76, 80, 117, 138, 169, 260, 265, 306, 324, 336, 371, 391, 397, 406, 438], "take": [64, 293, 390, 391, 392, 400, 427, 430, 433, 436, 437, 440, 442, 443, 444, 448, 454, 456], "pass": [14, 55, 64, 85, 89, 109, 392, 396, 409, 410, 411, 436], "locat": [80, 320, 328, 396, 453, 455], "note": [58, 64, 65, 77, 81, 163, 170, 176, 427, 430, 448], "must": [39, 393, 400, 407, 428, 430, 433], "accept": [64, 391], "port": [64, 65, 77], "password": [64, 65, 77], "problem_nam": [391, 428, 436], "configur": 110, "dictionari": [64, 436], "problem_factori": [436, 451, 453, 455], "only_avail": [], "includ": [11, 21, 138, 393, 394, 397, 404, 406, 430, 438, 441, 444, 448], "can": [6, 45, 54, 64, 77, 89, 138, 146, 205, 256, 257, 261, 266, 391, 392, 393, 395, 396, 397, 398, 401, 402, 403, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 427, 428, 429, 430, 431, 432, 434, 436, 437, 438, 440, 441, 442, 443, 445, 448, 450, 452, 454], "import": [39, 59, 80, 111, 244, 245, 391, 392, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "directli": [312, 396, 441], "problem_list": [], "repositori": [56, 57, 58, 59, 107, 132, 179, 306, 312, 390, 392, 393, 394, 397, 409, 422, 423, 430, 436, 440], "otherwis": [50, 84, 396, 410, 411], "user": [58, 64, 93, 163, 170, 176, 204, 376, 380, 391, 392, 396, 436, 437, 438, 440, 441], "readili": [], "conda_environment_nam": 391, "python_path": 74, "conda": [6, 74, 117, 138, 324, 336, 371, 392, 394, 397, 409, 437, 441, 442, 443, 445, 448, 452, 454], "environ": [6, 58, 74, 117, 324, 336, 371, 390, 392, 393, 394, 396, 397, 427, 428, 437, 441, 442, 443, 445, 448, 452, 454], "python": [45, 74, 79, 102, 111, 138, 162, 169, 175, 270, 390, 391, 392, 393, 394, 406, 443], "With": [], "instanti": [55, 77, 109, 111, 392, 437, 438], "separ": [], "also": [138, 169, 391, 392, 393, 394, 397, 409, 410, 411, 427, 430, 436, 438, 440, 450], "later": [], "append": [437, 438], "overwrit": [58, 81, 438], "exist": [58, 59, 391, 396, 436], "quiet": [109, 396], "correspond": [118, 133, 183, 337, 396, 407, 427, 454], "objective_repositori": [391, 393, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 440, 441, 442, 444, 446, 448, 450, 451, 453, 454, 455, 456], "yaml": [], "said": [391, 392, 409, 437], "enviro": 437, "sinc": [85, 138, 376, 391, 392, 395, 396, 397, 404, 406, 409, 430, 437, 440, 442, 443, 444, 448, 454, 456], "t": [13, 14, 79, 115, 122, 125, 128, 137, 141, 149, 162, 169, 175, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 270, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 391, 392, 394, 395, 396, 404, 406, 407, 409, 438, 441], "depend": [6, 391, 392, 394, 396, 428, 440, 441, 445, 452], "instal": [57, 163, 170, 176, 394, 396, 410, 411, 428, 436, 440, 441], "squelch": 109, "feedback": [109, 396], "creation": [39, 109, 391, 430, 451], "registr": [117, 260, 265, 324, 336], "conda_environment_loc": [], "extern": [54, 55, 76, 440], "externalobserv": 435, "relev": [371, 392, 396, 409, 430, 436], "script_file_nam": [], "run_script": [64, 74], "call": [39, 58, 64, 76, 77, 109, 117, 163, 170, 176, 324, 336, 391, 392, 393, 394, 395, 396, 409, 436, 438, 440, 441], "monitor": 39, "progress": [39, 58, 89, 437], "valu": [39, 79, 101, 102, 109, 111, 187, 188, 194, 322, 396, 407, 409, 413, 414, 420, 426, 430, 434, 436], "decis": 39, "variabl": [39, 58, 261, 266, 396, 409, 427, 430], "iter": [39, 45, 392, 437, 440, 446], "np": [39, 111, 306, 325, 391, 392, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "ndarrai": [39, 192, 290, 291, 292, 294, 295, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 325, 391, 392, 407, 436, 437, 438], "y": [39, 55, 79, 111, 188, 194, 220, 229, 391, 392, 398, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434, 436, 437, 438], "everi": [39, 438], "time": [39, 65, 391, 396, 416, 417, 427, 438, 451], "initialize_observ": [39, 55, 438], "problem_setup_info": [39, 438], "caller_info": [39, 55, 111, 438], "x0": [21, 55, 391, 392, 393, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 446, 448, 450, 451, 452, 453, 454, 455, 456], "y0": [21, 55, 392, 409, 428, 436, 437, 440, 442, 443, 444, 446, 448, 450, 451, 452, 453, 454, 455, 456], "seed": [39, 55, 109, 111, 210, 295, 383, 391, 392, 407, 438], "necessari": [39, 81, 391, 409, 410, 411, 442], "finish": [39, 55, 396, 427, 438], "perform": [39, 101, 102, 118, 163, 176, 261, 266, 390, 392, 394, 396, 427, 436, 437, 444, 446, 448], "ani": [39, 64, 198, 199, 391, 396, 433, 436, 438, 440], "cleanup": 39, "final": [39, 392, 438], "step": [39, 409, 436, 440], "complet": [39, 396, 452], "model": [13, 42, 80, 115, 122, 125, 128, 132, 133, 134, 149, 187, 188, 200, 204, 206, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 274, 283, 286, 304, 331, 334, 341, 390, 391, 396, 397, 398, 401, 402, 403, 404, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 443, 444, 448, 454, 456], "check": [42, 60, 80, 83, 146, 328, 392, 394, 396, 397, 407, 410, 411, 420, 430, 437, 438, 440, 441], "inde": [42, 396, 410, 411], "gener": [44, 45, 64, 74, 99, 100, 101, 102, 109, 111, 220, 229, 337, 390, 392, 396, 407, 412, 415, 424, 427, 442, 443, 444, 448, 454, 456], "chunk_siz": 45, "element": [45, 436, 440], "3": [13, 45, 182, 183, 220, 229, 271, 274, 390, 391, 392, 393, 394, 396, 398, 400, 401, 402, 403, 405, 408, 409, 410, 411, 412, 413, 414, 416, 417, 418, 419, 421, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 440, 443, 444, 446, 450], "12": [45, 80, 150, 242, 244, 245, 256, 257, 390, 397, 409, 410, 411, 420, 426, 430], "replac": [45, 83, 85, 256, 257, 291, 397, 436, 453, 455], "built": [45, 186, 393], "itertool": 45, "doc": [45, 58, 396], "html": [45, 306, 390, 430, 436, 440, 442, 450, 454, 456], "yield": [45, 132, 133, 134, 390, 404], "tupl": [45, 83, 84, 325, 391], "equal": [45, 83], "exampl": [45, 59, 61, 83, 85, 111, 117, 327, 383, 391, 393, 394, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 440, 441, 451], "4": [45, 193, 206, 220, 229, 390, 395, 405, 406, 407, 412, 415, 424, 427, 440, 448], "5": [45, 81, 117, 118, 119, 265, 267, 318, 393, 394, 396, 399, 400, 412, 415, 430, 438, 440, 445, 451], "6": [45, 390, 396, 412, 415, 420, 436, 440], "7": [45, 81, 396, 410, 411, 440], "8": [45, 132, 133, 134, 390, 396, 404, 407, 424, 427, 440], "9": [45, 137, 220, 229, 390, 391, 393, 394, 396, 404, 405, 436, 440, 441], "rdkit": [47, 48, 49, 50, 59, 258, 260, 261, 263, 265, 266, 390, 394, 399, 404, 422, 423, 424], "selfies_str": [48, 51], "chem": [13, 14, 48, 49, 50, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 261, 265, 266, 277, 278, 283, 286, 304, 331, 334, 341], "mol": [48, 49, 50], "convert": [48, 49, 50, 64, 182, 183, 188, 193], "selfi": [14, 48, 50, 51, 52, 115, 133, 142, 238, 246, 260, 261, 265, 266, 279, 394, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 429, 431, 432, 434, 445, 452], "strict": [48, 49, 51, 52, 58, 83], "error": [48, 49, 51, 52, 58, 80], "fail": [48, 261, 266], "decod": [48, 198, 204, 205], "smiles_str": [49, 51, 52], "cannot": [49, 51, 52, 261, 266], "pars": [49, 51, 52, 86, 87, 88, 89, 261, 266, 292], "molecule_str": 50, "from_selfi": [50, 261, 266], "assum": [50, 85, 261, 266, 376, 391, 392, 396, 397, 410, 411, 428, 436, 437, 440, 442], "translat": [51, 52], "els": [51, 52], "those": [51, 52, 392], "aspuru": [51, 52, 390, 424], "guzik": [51, 52, 390, 424], "lab": [51, 52], "group": [51, 52], "isol": [6, 14, 15, 54, 55, 109, 111, 142, 371, 391, 394, 409, 428, 436, 438], "kwargs_for_observ": 55, "send": [55, 77], "verifi": [55, 60, 438], "wa": [55, 57, 85, 244, 245, 392, 396, 406, 427, 436, 437], "correctli": [55, 395], "setup_info": 55, "start": [55, 64, 76, 77, 256, 257, 392, 396, 397, 436, 438, 440, 441], "close": [55, 111, 146, 390, 394, 398, 401, 402, 403, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434], "__getattr__": 55, "__name": 55, "retriev": [55, 77, 143], "attribut": [55, 77, 198, 199, 396, 436], "underli": [55, 405, 412], "download": [56, 57, 58, 60, 138, 391, 395, 397, 409, 436], "github": [56, 57, 58, 59, 138, 391, 392, 393, 394, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "pygithub": [57, 59, 409], "pip": [57, 138, 391, 392, 393, 394, 396, 409, 441], "most": [57, 185, 399, 440], "code": [57, 60, 200, 256, 257, 391, 396, 409], "taken": [57, 312, 397, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 441], "adapt": [57, 271, 274, 390, 394, 396, 446, 448, 450], "gist": 57, "com": [57, 58, 137, 138, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "pdashford": 57, "2e4bcd4fc2343e2fd03efe4da17f577d": 57, "permalink_comment_id": 57, "4274705": 57, "gistcom": 57, "repository_nam": 58, "file_path_in_repositori": 58, "download_path_for_fil": 58, "tag": [58, 59], "master": [58, 393], "commit_sha": [58, 59], "exist_ok": [58, 396, 438], "parent_folders_exist_ok": 58, "i": [58, 79, 118, 146, 162, 169, 175, 187, 261, 266, 270, 274, 322, 337, 371, 390, 392, 394, 396, 397, 404, 407, 411, 433, 437, 438], "repo": [58, 138, 393], "download_path": 58, "branch": [58, 59, 393], "sha": [58, 59], "commit": [58, 59, 397], "exists_ok": 58, "parent": [58, 396, 397, 438, 451], "thei": [21, 58, 80, 146, 244, 245, 246, 396, 407, 420, 438, 448], "do": [58, 138, 244, 245, 391, 392, 396, 409, 420, 427, 437, 441], "except": [58, 65, 77], "github_token_for_poli": [58, 409], "doe": [53, 58, 244, 245], "try": [58, 410, 411], "without": [58, 369, 391, 392, 411, 437], "rate": 58, "limit": [58, 328, 397, 409], "60": 58, "request": [58, 396], "per": 58, "hour": 58, "anonym": [58, 409], "To": [58, 391, 393, 394, 395, 396, 420], "token": [58, 193, 261, 266, 291, 293, 391, 409, 427, 453, 455], "like": [58, 111, 138, 315, 390, 391, 392, 395, 406, 424, 427, 430, 437, 438, 440, 441, 442, 443, 444, 448, 454, 456], "follow": [11, 21, 58, 79, 391, 392, 393, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 440, 442, 443, 445, 448, 450, 452, 454, 456], "instruct": [58, 391, 392, 440], "here": [58, 391, 392, 394, 396, 397, 409, 413, 414, 426, 434, 436, 441, 442, 443, 445, 448, 451, 452, 454], "en": [58, 327, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 436, 440, 443, 450, 454], "authent": [58, 64, 65], "keep": [58, 85, 301, 410, 411, 448], "your": [6, 58, 138, 392, 395, 396, 397, 406, 409, 410, 411, 428, 438, 441], "account": 58, "secur": 58, "person": [58, 409], "fine": [58, 393], "grain": 58, "get_repo": 59, "release_2023_09": 59, "068441957858f786c227825d90eb2c43f4f2b000": 59, "internet": 60, "reproduc": 60, "purpos": 60, "make": [60, 301, 380, 393, 395, 396, 397, 409, 427, 451], "sure": [60, 393, 395, 396, 397, 409, 427, 438], "malici": 60, "being": [60, 301, 395, 397, 409], "filepath": 61, "read_mod": 61, "rb": 61, "md5": [61, 397], "hex": 61, "digest": 61, "open": [61, 256, 257, 390, 396, 422, 423, 438, 443], "binari": [61, 81, 138, 163, 170, 176, 396, 409, 410, 411], "form": [11, 61, 146, 390, 394, 396, 407], "mode": [61, 82], "read": [61, 81, 195, 396, 413, 414, 426, 434, 438], "hex_digest": 61, "txt": [61, 81, 85, 391, 395, 396, 409, 410, 411, 438], "d41d8cd98f00b204e9800998ecf8427": 61, "wrap": [62, 63], "interprocess": [62, 63], "commun": [6, 62, 63, 64, 391, 422, 423], "kwargs_for_factori": [64, 109, 111], "connect": [64, 65, 77, 204], "inter": 64, "These": [64, 146, 391, 394, 396, 397, 399, 407, 409, 430, 436, 438, 440], "inner": [64, 371], "up": [64, 65, 392, 404, 406, 427, 437, 438], "listen": 64, "random": [64, 99, 100, 101, 102, 109, 111, 146, 392, 394, 405, 407, 412, 415, 437, 440, 442, 443, 444, 446, 448, 450, 451, 454, 455, 456], "subprocess": [64, 396], "expect": [6, 64, 80, 81, 82, 85, 138, 163, 170, 176, 371, 391, 392, 394, 396, 397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 438, 442, 443, 445, 448, 450, 452, 454, 456], "well": [64, 393, 396, 404, 441, 444], "other": [14, 64, 115, 261, 266, 391, 392, 395, 436, 438, 441], "objective_factori": [64, 369, 391, 393, 409, 428, 438, 440, 443, 445, 452], "determin": 64, "client": 65, "get": [65, 76, 89, 371, 391, 392, 396, 399, 413, 414, 426, 434, 437, 438, 440], "eoferror": 65, "host": 65, "readi": [65, 188], "yet": [65, 391, 437], "connectionrefusederror": 65, "refus": 65, "attempt": 65, "establish": [65, 77], "retri": 65, "befor": [65, 74, 392, 436], "conda_environ": 74, "cwd": [74, 396], "activ": [74, 391, 393, 394, 409, 438, 442, 443, 445, 448, 452, 454], "ad": [74, 138, 369, 406, 438], "current": [74, 413, 414, 426, 428, 434, 440, 441], "either": [14, 133, 142, 279, 396, 397, 407, 409, 428, 438, 450], "mother": [76, 77], "receiv": 77, "wait": 77, "occur": 77, "sent": 77, "back": [77, 289], "quit": [77, 391, 397, 440], "messag": [77, 109], "encod": [79, 191, 192, 204, 205, 409], "For": [79, 85, 138, 187, 242, 256, 257, 328, 376, 391, 394, 396, 406, 409, 430, 438, 440, 441, 446], "amino_acid": 79, "n": [13, 79, 115, 122, 125, 128, 132, 133, 134, 146, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 328, 331, 334, 341, 390, 393, 394, 396, 398, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 430, 431, 432, 433, 434, 438, 450], "d": [79, 256, 257, 306, 322, 390, 395, 397, 407, 430, 438, 452, 454, 456], "c": [79, 132, 133, 134, 390, 393, 396, 398, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434, 438, 441, 448], "q": [79, 390, 407, 438], "h": [79, 117, 118, 119, 274, 294, 390, 398, 401, 402, 403, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 438], "k": [13, 14, 79, 115, 122, 125, 128, 137, 141, 146, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 260, 277, 278, 283, 286, 304, 318, 331, 334, 341, 390, 407, 438], "m": [79, 137, 193, 256, 257, 390, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 438, 442, 443, 445, 448, 450, 452, 454, 456], "p": [79, 390, 407, 438], "v": [79, 81, 407, 438], "measur": [80, 115, 187, 238, 396, 422, 423], "stabil": [80, 81, 165, 169, 170, 172, 175, 256, 257, 268, 270, 390, 393, 394, 396, 399, 410, 441], "sasa": [80, 81, 158, 162, 163, 164, 172, 175, 176, 177, 268, 270, 394, 399, 410, 411], "foldxinterfac": 80, "queri": [80, 146, 391, 392, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 437], "heavili": [6, 80, 396], "inspir": [80, 396], "wai": [21, 80, 392, 393, 396, 407, 437, 438, 440, 441], "lambo": [80, 138, 150, 242, 244, 245, 246, 394, 396, 399, 410, 411, 436], "automat": [80, 111, 390, 391, 395], "acceler": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "bayesian": [80, 150, 242, 244, 245, 376, 390, 392, 394, 409, 410, 411, 420, 437, 443, 445, 452], "biolog": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "design": [13, 80, 115, 122, 125, 128, 132, 133, 134, 137, 149, 150, 204, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 283, 286, 304, 331, 334, 341, 390, 391, 392, 394, 395, 398, 399, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 425, 426, 429, 431, 432, 434, 436, 437, 440], "withdenois": 80, "autoencod": [80, 150, 204, 242, 244, 245, 390, 409, 410, 411, 420, 442, 443, 444, 448, 454, 456], "stanton": [80, 146, 150, 242, 244, 245, 390, 395, 396, 407, 409, 410, 411, 420, 436], "samuel": [80, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 452], "weslei": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "maddox": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "nate": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "gruver": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "phillip": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "maffetton": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "emili": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "delanei": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "peyton": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "greensid": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "andrew": [80, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420], "gordon": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "wilson": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "arxiv": [13, 80, 146, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 445, 448], "juli": [80, 150, 242, 244, 245, 390, 409, 410, 411, 412, 415, 420], "ab": [13, 80, 146, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 445, 448], "2203": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "12742": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "samuelstanton": [80, 138, 409], "working_dir": [81, 396], "interact": [81, 396], "engin": [81, 306, 430, 440, 444], "softwar": [81, 395, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "where": [81, 117, 118, 119, 205, 391, 392, 394, 396, 427, 437, 441, 442, 443, 445, 448, 452, 454], "store": [81, 392, 397, 436, 441], "pdb_file": 81, "remove_and_renam": 81, "ph": [81, 396, 410, 411], "remove_heteroatom": 81, "_repair_if_necessary_and_provide_path": 81, "_simulate_mut": 81, "_read_energi": 81, "_compute_sasa": 81, "solvent": [81, 158, 163, 164, 172, 176, 177, 268, 390, 394, 396, 399], "surfac": [81, 158, 163, 164, 172, 176, 177, 268, 394, 396, 399, 410], "area": [81, 158, 163, 164, 172, 176, 177, 268, 394, 396, 399, 410], "compute_st": 81, "structur": [81, 87, 88, 89, 138, 170, 392, 396, 406, 438], "compute_sasa": 81, "compute_stability_and_sasa": 81, "singl": [81, 85, 256, 257, 306, 390, 394, 397, 399, 420, 422, 423, 430, 436, 438, 444, 450], "copy_foldx_fil": 81, "copi": [81, 391, 392, 396, 437, 451], "write_mutations_to_fil": 81, "wildtype_resiud": 81, "output_dir": 81, "write": [81, 138, 371, 391, 393, 396, 406, 435, 438, 439, 447, 449], "stdout": 81, "previou": [81, 396, 438], "reli": [81, 369, 430, 448, 454], "rotabas": [81, 395, 396, 409, 410, 411], "longer": 81, "manipul": [82, 391, 393, 394], "accord": [82, 186, 396, 440], "certain": [82, 128, 146, 304, 331, 394, 396, 403, 404, 407, 425, 454], "first": [82, 83, 85, 391, 392, 394, 396, 399, 400, 436, 437], "letter": [82, 85, 117, 118, 119, 394, 396, 399, 400], "second": [82, 83, 85, 196, 394, 396, 399], "posit": [82, 83, 85, 185, 190, 392, 396, 397, 436, 437, 440], "third": [82, 85], "chain": [82, 85, 396, 397], "fourth": [82, 85], "mutant": [82, 84, 85, 256, 257, 392, 396, 437], "foldxsuit": [82, 395, 396], "crg": [82, 395, 396], "eu": [82, 395, 396], "string_1": 83, "string_2": 83, "edit": [83, 256, 257, 397], "oper": [83, 395], "assertionerror": 83, "abc": 83, "abd": 83, "def": [83, 391, 392, 437, 438], "wildtype_pdb_fil": [84, 410, 411], "mutated_residue_str": [84, 85], "return_hamming_dist": 84, "find": [84, 117, 118, 119, 138, 391, 397, 404, 406, 438, 440, 442, 443, 445, 448, 452, 454], "closest": 84, "ham": 84, "distanc": [84, 85, 118, 397, 400], "along": 84, "best": [84, 392, 436, 437, 446, 451], "candid": [84, 392, 440], "found": [84, 393, 396, 436, 440], "bio": [85, 88, 89, 396], "individual_list": [85, 396], "levenshtein": 85, "track": [85, 390, 438], "written": 85, "line": [85, 394, 396], "ea1r": 85, "still": [85, 441], "need": [11, 85, 138, 391, 392, 395, 396, 406, 409, 410, 411, 436, 438], "dummi": 85, "itself": [85, 391, 393], "ecd": 85, "acd": 85, "would": [85, 391, 392, 396, 397, 438], "ea1a": 85, "load": [86, 110, 179, 187, 196, 396, 438], "them": [86, 138, 376, 391, 392, 393, 396, 397, 399, 406, 437, 440, 445, 452], "path_to_pdb": [87, 88, 89], "structure_nam": [87, 88, 89], "done": [89, 138, 396, 409, 420, 440], "quietli": 89, "some": [89, 200, 246, 376, 392, 393, 394, 396, 409, 430, 438, 440], "get_structur": [89, 396], "pdbparser": [89, 396], "numpi": [101, 271, 292, 391, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 438, 441, 442, 443, 444, 445, 448, 450, 451, 452, 453, 454, 455, 456], "obj": [], "dynam": 391, "intern": [390, 391, 412, 415, 424, 428, 450], "constructor": [], "factory_kwarg": [], "processwrapp": [], "how": [138, 391, 392, 393, 394, 396, 399, 436, 437, 438, 440], "objective_nam": [], "loop": [369, 390, 442, 443, 444, 448, 454, 456], "process_wrapp": [], "observer_init_info": 109, "force_regist": [], "force_isol": [4, 14, 109, 111, 133, 142, 163, 170, 176, 210, 246, 261, 279, 391, 407], "instantiant": 109, "associ": [109, 390, 436, 441, 442, 456], "caller": [109, 111, 438], "forward": [109, 111, 438], "logger": [109, 111], "ask": 392, "confirm": [], "By": [109, 261, 266, 325, 391, 392, 407, 410, 411, 444, 450], "onc": [109, 391, 392, 427, 440], "round": [109, 337], "down": 109, "give": [109, 290, 376, 391], "config": [110, 371], "configpars": 110, "just": [53, 111, 391, 409, 436, 438], "One": [111, 395, 440, 450], "aloha": [111, 393, 394, 399, 436, 437, 440, 451], "arrai": [111, 182, 183, 192, 193, 289, 292, 294, 391, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 441, 452], "reshap": [111, 392, 420, 422, 427, 442, 443, 444, 448, 450, 454, 456], "simpl": [117, 118, 119, 132, 133, 134, 186, 260, 261, 265, 266, 392, 436, 437, 440], "goal": [117, 118, 119, 301], "o": [117, 118, 119, 390, 398, 400, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 438, 441, 448], "among": [115, 117, 118, 119, 395, 396], "poli__bas": [117, 324, 336], "yml": [117, 138, 324, 336, 392, 397, 409, 442, 443, 445, 448, 452, 454], "simultan": [14, 118, 133, 142, 261, 266, 279, 397], "map": [118, 133], "symbol": [118, 133], "main": [6, 118, 261, 266, 392, 393, 394, 395, 396, 437, 438], "api": [132, 133, 134, 393, 409], "assess": [132, 133, 134, 256, 257, 394, 399], "small": [132, 133, 134, 261, 391, 393, 404, 405, 406, 424, 438, 440], "protein": [132, 133, 134, 146, 162, 169, 170, 175, 256, 257, 270, 390, 393, 395, 397, 404, 406, 407, 440, 441], "easi": [132, 133, 134, 146, 390, 396, 404, 407, 440], "molecular": [13, 115, 122, 125, 128, 132, 133, 134, 137, 149, 162, 169, 175, 223, 226, 232, 235, 238, 241, 250, 253, 270, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "better": [132, 133, 134, 390, 396, 404], "benchmark": [13, 21, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 306, 324, 328, 331, 334, 341, 390, 392, 398, 399, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 430, 431, 432, 434], "ligand": [132, 133, 134, 390, 394, 399, 404], "garc\u00eda": [132, 133, 134, 390, 404], "orteg\u00f3n": [132, 133, 134, 390, 404], "miguel": [132, 133, 134, 390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "gregor": [132, 133, 134, 390, 404], "simm": [132, 133, 134, 390, 404], "austin": [132, 133, 134, 390, 404], "tripp": [132, 133, 134, 390, 404], "jos\u00e9": [132, 133, 134, 256, 257, 390, 397, 404], "hern\u00e1ndez": [132, 133, 134, 390, 404], "lobato": [132, 133, 134, 390, 404], "andrea": [132, 133, 134, 390, 404, 450], "bender": [132, 133, 134, 390, 404], "sergio": [132, 133, 134, 390, 404], "bacallado": [132, 133, 134, 390, 404], "journal": [132, 133, 134, 137, 220, 229, 390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 431, 432, 434], "62": [132, 133, 134, 390, 404], "15": [132, 133, 134, 390, 404, 414, 451], "august": [132, 133, 134, 390, 404], "3486": [132, 133, 134, 390, 404], "3502": [132, 133, 134, 390, 404], "1021": [13, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "ac": [13, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 427, 429, 431, 432, 434], "jcim": [13, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1c01334": [132, 133, 134, 390, 404], "target_nam": [133, 404, 441], "string_represent": [14, 133, 142, 246, 261, 266, 279, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 429, 431, 432, 434, 445, 452], "liter": [14, 133, 142, 210, 246, 261, 266, 279, 328], "There": [138, 413, 414, 426, 434, 436, 438], "sever": [138, 306, 315, 324, 396, 397, 416, 417], "prepare_receptor": 138, "rest": [138, 438, 440], "descript": [138, 438], "show": [138, 393, 396, 436], "center": [138, 406], "websit": [138, 406], "scripp": 138, "edu": [138, 220, 229], "uncompress": [138, 406], "add": [138, 187, 290, 391, 392, 409, 410, 411, 420, 437, 452], "export": [138, 406], "autodock_vina": [138, 406], "bin": [138, 406], "bashrc": [138, 406], "zshrc": [138, 406], "bash": 138, "In": [137, 138, 242, 246, 390, 392, 393, 396, 397, 406, 409, 410, 411, 427, 428, 430, 436, 437, 438, 440, 441, 446, 450, 451, 452], "ccsb": 138, "sh": [138, 406], "thu": [138, 406], "might": [138, 306, 391, 393, 396, 406, 409, 410, 411, 420, 430, 436, 438], "chang": [138, 162, 169, 175, 179, 196, 270, 393, 395, 396, 406, 411, 430], "its": [11, 21, 138, 392, 396, 406, 410, 437, 441], "permiss": [138, 406], "chmod": [138, 406], "abl": [138, 391, 393, 395, 396, 406, 427, 438, 440, 441], "pyscreen": [138, 394, 406], "howev": [138, 397, 406], "sometim": [138, 406], "problemat": [138, 406], "ha": [138, 315, 325, 391, 392, 396, 406, 413, 414, 436, 437, 441, 446], "symlink": [138, 406], "ln": [138, 406], "sf": [138, 406], "easili": [138, 396, 436], "env": [138, 391, 393, 409, 436, 440, 441, 442, 443, 445, 448, 452, 454], "src": [93, 138, 409, 442, 443, 445, 448, 452, 454], "ddr3_dock": 138, "task": [115, 122, 125, 128, 137, 138, 141, 149, 150, 196, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 396, 398, 401, 402, 403, 405, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 444], "git": [138, 391, 392, 393, 394, 409], "clone": [138, 393, 397, 409, 428, 442, 443, 445, 448, 452, 454], "431b052": [138, 409], "cd": [138, 393, 409], "particular": [138, 246, 268, 409, 430, 436, 438, 441], "proxy_rfp": [138, 409], "proxyrfptask": [138, 409], "rfp": [138, 150, 152, 153, 268, 394, 399], "asset": [138, 409], "fpbase": [138, 409], "And": [138, 436], "now": [138, 391, 393, 396], "py": [6, 93, 138, 328, 392, 393, 396, 436, 437, 438, 440, 441], "query_exampl": 138, "ddr3": [], "et": [13, 14, 115, 122, 125, 128, 137, 141, 146, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 394, 395, 396, 397, 398, 399, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 431, 432, 434, 436, 442, 443, 444, 445, 448, 450, 451, 452, 454, 456], "al": [13, 14, 115, 122, 125, 128, 137, 141, 146, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 274, 277, 278, 283, 286, 304, 306, 328, 331, 334, 341, 390, 394, 395, 396, 397, 398, 399, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 442, 443, 444, 445, 448, 450, 451, 452, 454, 456], "nat": [13, 14, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "biol": [13, 14, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "1036": [13, 14, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "self": [14, 142, 391, 392, 397, 437, 438], "tdcblackbox": [], "denois": [150, 242, 244, 245, 390, 409, 410, 411, 420], "alia": [], "base_candid": [], "specifc": [], "predict": [137, 158, 186, 187, 207, 256, 257, 390, 394, 396, 399, 444], "pair": [162, 175, 270], "biopython": [162, 169, 175, 270, 396, 410, 441], "cock": [162, 169, 175, 270], "pa": [162, 169, 175, 270], "antao": [162, 169, 175, 270], "jt": [162, 169, 175, 270], "chapman": [162, 169, 175, 270], "ba": [162, 169, 175, 270], "cox": [162, 169, 175, 270], "cj": [162, 169, 175, 270], "dalk": [162, 169, 175, 270], "friedberg": [162, 169, 175, 270], "hamelryck": [162, 169, 175, 270], "kauff": [162, 169, 175, 270], "wilczynski": [162, 169, 175, 270], "b": [162, 169, 175, 270, 294, 391, 393, 400, 427, 428, 430, 433, 438, 440, 442], "de": [13, 115, 122, 125, 128, 137, 149, 162, 169, 175, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 270, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "hoon": [162, 169, 175, 270], "mjl": [162, 169, 175, 270], "2009": [162, 169, 175, 270, 390, 424, 427], "freeli": [162, 169, 175, 270], "tool": [162, 169, 175, 270, 441], "bioinformat": [162, 169, 175, 270], "25": [162, 169, 175, 270, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1422": [162, 169, 175, 270], "1423": [162, 169, 175, 270], "usual": [6, 115, 238, 321, 324, 391, 392, 394, 399, 430, 438, 444, 448], "eager": [163, 176], "v5": [163, 170, 176], "compil": [163, 170, 176, 206, 397], "specif": [128, 163, 170, 176, 430, 440], "foldxblackbox": [], "pre": [169, 393, 397, 410, 411, 441], "20": [390, 407, 427], "shown": [], "core": [380, 391, 392, 435, 436, 437, 442, 448, 451, 454], "through": [125, 137, 170, 304, 331, 390, 392, 393, 405, 437, 440], "total": [170, 186, 396], "cba": [179, 196, 198], "vae": [179, 196, 198, 199, 205, 206, 210, 442, 443, 444, 448, 454, 456], "sb": [179, 196], "bo": 179, "minor": [179, 196], "modif": [179, 196], "conduct": [179, 196], "rm": [179, 196], "creator": [179, 196], "last": [179, 196, 396], "x_aa": [182, 183, 192], "aa_idx": 182, "arn": [182, 183], "becom": [182, 183, 396], "row": [182, 183, 396], "base_seq": 184, "wild": [184, 189, 396], "mtuation": 184, "xt_p": [185, 190], "categor": [185, 190, 208], "probabl": [185, 190], "distribut": [185, 190, 208, 390, 446], "pred": 186, "xt": 186, "predictor": 186, "balaji": 186, "lakshminarayanan": 186, "paper": [186, 198, 220, 229, 390, 407, 441, 442, 456], "scalabl": [186, 390, 456], "uncertainti": [186, 390, 444, 454], "estim": [186, 242, 263, 265, 266, 267, 390, 393, 394, 399, 424], "deep": [137, 186, 256, 257, 390, 397, 405, 427, 442, 443, 444, 448, 454, 456], "ensembl": 186, "2017": [137, 186, 220, 229, 390, 397, 405], "varianc": 186, "random_st": [187, 194], "train_siz": [187, 194], "5000": 187, "return_test": [187, 194], "return_al": 187, "gfp": [187, 188, 189, 195], "test": [146, 187, 306, 390, 392, 407, 430, 437], "ground": [187, 427], "truth": 187, "gp": [187, 210, 211], "partit": [187, 194, 422], "below": 187, "20th": 187, "percentil": [187, 194], "nois": [187, 335, 336, 337, 383, 394, 399, 440], "data_df": 188, "panda": [188, 195, 396], "datafram": [188, 195, 396], "functional_onli": [188, 210], "ignore_stop": [188, 210], "return_str": 188, "raw": 188, "sampl": [13, 146, 190, 295, 390, 405, 407, 412, 415, 433, 438, 444, 453, 454, 455], "aa_str": 191, "pad": [191, 193, 290, 391, 452], "hot": [191, 294], "onehot": 192, "alphabet_s": [192, 392, 437], "dna_str": 193, "base_ord": 193, "atcg": 193, "40": 194, "1000": 194, "df_save_fil": 195, "bright": 195, "author": [196, 242, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "credit": 196, "herculean": 196, "go": [196, 394, 395], "aa": [197, 198, 199, 274], "mimic": 198, "kera": [198, 204], "latent_dimension": [198, 199], "enc1_unit": [198, 199, 206], "train": [200, 405, 412, 415, 454], "gaussian": [200, 336, 337, 390, 394, 399, 433, 444, 454], "regress": 200, "sarkisyan": 200, "2016": [200, 390, 427, 442, 443, 444, 448, 454, 456], "plu": [200, 451], "constant": [200, 430, 448], "input_shap": [204, 205], "latent_dim": [204, 205, 206], "variat": [204, 442, 443, 444, 448, 454, 456], "via": [204, 390, 438, 450, 452, 456], "latent": [204, 390, 392, 427, 437, 442, 443, 444, 448, 454, 456], "space": [204, 291, 376, 390, 392, 427, 437, 442, 443, 444, 445, 448, 450, 452, 454, 456], "flatten": [205, 392, 427, 436, 437], "basic": [205, 369, 440], "layer": 205, "n_token": 206, "seq_length": 206, "50": [206, 446], "eps_std": 206, "y_true": [207, 208], "y_pred": [207, 208], "likelihood": 208, "uniqu": [210, 438], "problem_typ": [210, 211], "exact": [242, 392, 437], "logp": [242, 244, 245, 246, 258, 260, 261, 394, 399], "jointli": 242, "quantit": [242, 263, 265, 266, 267, 393, 394, 399], "druglik": [242, 263, 265, 266, 267, 393, 394, 399], "qed": [242, 261, 263, 265, 266, 267, 394, 399], "penal": [242, 246, 394, 399], "solubl": [242, 258, 260, 261, 394, 399], "fair": 242, "comparison": [242, 438], "_exactly_": [244, 245], "adjust": 246, "magic": 246, "empir": [246, 420], "standard": [21, 246, 336, 337, 420, 433, 448], "deviat": [246, 420], "dataset": [220, 229, 246, 306, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 429, 430, 431, 432, 434], "todo": [396, 435, 439, 447, 449], "rapid": [256, 257, 390, 394, 399], "sourc": [256, 257, 390, 391, 422, 423, 443], "bird": [256, 257], "ey": [256, 257], "view": [256, 257, 396], "collect": [256, 257, 305, 394, 397, 407], "site": [256, 257, 436, 440, 441], "reader": [256, 257], "consid": [256, 257, 397, 407, 427, 430], "drop": [256, 257, 397, 436, 440], "rosetta": [256, 257, 397], "learn": [137, 256, 257, 390, 397, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 443, 450], "blaabjerg": [256, 257, 390, 397], "lass": [256, 257, 390, 397], "maher": [256, 257, 390, 397], "kassem": [256, 257, 390, 397], "lydia": [256, 257, 390, 397], "good": [256, 257, 390, 391, 393, 394, 397, 427], "nicola": [256, 257, 390, 397], "jonsson": [256, 257, 390, 397], "matteo": [256, 257, 390, 397], "cagiada": [256, 257, 390, 397], "kristoff": [256, 257, 390, 397], "johansson": [256, 257, 390, 397, 424], "wouter": [256, 257, 390, 397], "boomsma": [256, 257, 390, 397], "ameli": [256, 257, 390, 397], "stein": [256, 257, 390, 397], "kresten": [256, 257, 390, 397], "lindorff": [256, 257, 390, 397], "larsen": [256, 257, 390, 397], "faraldo": [256, 257, 397], "g\u00f3mez": [256, 257, 390, 397, 442, 443, 444, 448, 454, 456], "detlef": [256, 257, 397], "weigel": [256, 257, 397], "nir": [256, 257, 397], "ben": [256, 257, 390, 397, 442], "tal": [256, 257, 397], "julian": [256, 257, 390, 397, 427], "echav": [256, 257, 397], "elif": [256, 257, 390, 397], "2023": [256, 257, 390, 395, 397], "e82593": [256, 257, 390, 397], "7554": [256, 257, 390, 397], "82593": [256, 257, 390, 397], "whose": [260, 265, 336, 409, 444], "quotient": [260, 394, 399], "descriptor": 260, "both": [115, 122, 125, 128, 137, 149, 223, 226, 232, 235, 238, 241, 250, 253, 260, 265, 283, 286, 304, 331, 334, 341, 396, 410, 411], "poli__chem": [], "want": [391, 392, 396, 410, 411, 440], "local": [271, 274, 315, 390, 393, 428, 438, 442, 443, 445, 448, 452, 454, 456], "environemnt": [], "extra": [391, 441], "interest": [393, 396, 397, 410, 411, 428, 430, 438, 440], "molfromsmil": [261, 266], "known": [21, 261, 266, 422, 436], "silent": [261, 266], "nan": [261, 266, 427], "someth": [261, 266, 391, 392, 427], "than": [261, 266, 376, 442, 443, 445, 448, 452, 454], "continu": [21, 265, 267, 305, 306, 324, 325, 376, 390, 399, 440, 445], "lipinski": [265, 267], "rule": [265, 267, 391], "strongli": [], "advic": 391, "heurist": 267, "discard": 267, "too": 267, "heavi": [267, 391], "pareto": 268, "front": 268, "accessibl": 275, "sa": [275, 394, 399, 424], "toi": [287, 305, 306, 324, 325, 328, 335, 337, 376, 392, 400, 427, 438, 451], "avout": 287, "super": [287, 301, 391, 392, 399, 437], "mario": [287, 291, 301, 390, 399], "bro": [287, 301, 399], "level": [287, 289, 290, 291, 292, 293, 294, 295, 301, 390, 396, 399, 427], "n_pad": 290, "left": 290, "room": 290, "agent": [290, 427], "land": 290, "clean": [291, 396], "remov": [291, 395, 410, 411], "11": [291, 294, 393, 404, 424, 441], "empti": 291, "level_txt": [292, 293], "n_sprite": 294, "integ": [294, 295, 392, 430, 433, 437, 440], "levels_onehot": 295, "probit": 295, "tensor_level": [], "torch": [], "tensor": [], "level_s": [], "14": 427, "could": [391, 392, 396, 397, 409, 436, 437, 440, 450], "mariogan": 427, "jar": 391, "prob_matrix": 297, "item": [297, 388], "sentenc": [], "shape": [11, 391, 392, 393, 400, 428, 430, 433, 437, 440, 452], "z_dim": [], "devic": [146, 407], "path_to_state_dict": [], "vaemario": [], "pretrain": [], "landscap": [271, 274, 306], "signatur": 306, "sign": [306, 430], "flip": [306, 430], "becaus": [306, 441], "re": [306, 390, 393, 396, 397, 437, 438, 442], "deal": 306, "ali": [306, 390, 430], "roomi": [306, 328, 390, 430], "2015": [306, 390, 430], "unconstrain": [306, 328, 390, 430], "www": [306, 390, 424, 430], "halifax": [306, 430], "nova": [306, 430], "scotia": [306, 430], "canada": [306, 430], "dalhousi": [306, 430], "univers": [306, 430], "electr": [306, 430], "surjanov": [306, 390, 430], "bingham": [306, 390, 430], "virtual": [306, 427], "sfu": [306, 390, 430], "ca": [306, 390, 430], "ssurjano": [306, 390, 430], "linebo": [312, 430, 450], "kirschnj": 312, "xy": [315, 319, 320], "cross": 315, "trai": 315, "maxima": [315, 319], "quilt": 315, "pattern": [128, 315, 392], "2d": [315, 319, 320, 376], "alpha": [318, 393, 444], "veri": 319, "flat": 319, "pi": 319, "egg": 320, "holder": 320, "especi": [320, 394], "difficult": 320, "know": [320, 392, 396, 436], "optima": [320, 328], "squar": 321, "norm": 321, "shift": 321, "awai": [321, 397], "bit": [321, 396], "normal": [322, 390, 441, 446], "903534": 322, "39": [322, 409], "16599": 322, "divid": 322, "dimens": [324, 325, 328, 376, 390, 430, 444, 448, 450], "focu": [324, 396, 436, 440], "ones": 324, "dimension": [324, 376, 390, 394, 442, 445, 448, 450, 454], "function_nam": [325, 430, 442, 443, 444, 448, 450, 454, 456], "n_dimens": [325, 430, 442, 443, 444, 446, 448, 450, 454, 456], "embed_in": [325, 328, 430], "randomli": [146, 325, 392, 407, 430, 436, 437, 440, 451, 453, 455], "embed": [325, 376, 390, 394, 430, 445], "emb": [325, 376, 430], "toycontinuousproblem": 325, "bound": [325, 443, 448], "lower": [325, 376], "upper": 325, "seri": 327, "testb": 327, "wikipedia": 327, "wiki": 327, "test_functions_for_optim": 327, "ackley_function_01": [328, 394, 399, 430, 442, 443, 444, 448, 450, 454, 456], "alpine_01": [328, 430], "alpine_02": [328, 430], "bent_cigar": [328, 430], "brown": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 328, 331, 334, 341, 390, 398, 399, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 430, 431, 432, 434], "chung_reynold": [328, 430], "cosine_mixtur": [328, 430], "deb_01": [328, 430], "deb_02": [328, 430], "deflected_corrugated_spr": [328, 430], "styblinski_tang": 328, "shifted_spher": [328, 430], "easom": [328, 394, 399, 430], "cross_in_trai": [328, 430], "egg_hold": [328, 430], "camelback_2d": [328, 430], "n_dim": 328, "definit": [328, 430], "white": [335, 336, 383, 394, 399, 440], "vector": [337, 407], "downward": 337, "exemplifi": 369, "Not": 369, "come": [11, 369, 404, 440], "benefit": 369, "intellisens": 369, "spawn": 391, "higher": [376, 396], "afford": 376, "intrins": 376, "actual": [376, 405, 412, 430], "readm": [], "verbatum": [], "fullnam": 388, "escap": 388, "underlin": 388, "block": 388, "rubric": 388, "endfor": 388, "endif": 388, "endblock": 388, "ar15": 390, "url": [390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "bkj": 390, "maximilian": [390, 452], "balandat": [390, 444, 450, 452], "brian": 390, "karrer": 390, "daniel": 390, "jiang": 390, "daulton": [390, 394, 452], "benjamin": [390, 424], "letham": [390, 442], "eytan": [390, 442, 452], "bakshi": [390, 442, 452], "botorch": [390, 444, 450, 456], "framework": [390, 427], "effici": [13, 390, 405, 412, 415, 438, 444], "mont": 390, "carlo": 390, "decemb": 390, "2020": [220, 229, 390, 412, 415, 424, 442, 444, 450, 451], "1910": 390, "06403": 390, "cs": [390, 407, 445, 448], "math": 390, "stat": [390, 448], "bkg": 390, "23": [390, 393], "bf17": 390, "je": 390, "frellsen": [390, 397], "spheric": 390, "convolut": [390, 427], "applic": [271, 274, 390], "guyon": 390, "u": [390, 438, 454], "von": 390, "luxburg": 390, "bengio": 390, "wallach": 390, "fergu": 390, "vishwanathan": 390, "garnett": 390, "editor": [390, 397], "advanc": [390, 442, 443, 452, 456], "neural": [390, 397, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 443, 452, 456], "system": [390, 395, 396, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 443, 452, 456], "volum": [390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 442, 456], "30": [390, 430], "curran": [390, 442, 456], "inc": [390, 442, 456], "proceed": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 442, 450, 454, 456], "neurip": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 456], "cc": [390, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 441, 442, 456], "paper_fil": 390, "1113d7a76ffceca1bb350bfe145467c6": 390, "pdf": [220, 229, 390], "dpam02": 390, "deb": [390, 451], "pratap": 390, "agarw": 390, "meyarivan": 390, "fast": 390, "elitist": 390, "multiobject": 390, "genet": [271, 274, 390, 427, 451], "nsga": 390, "ii": [371, 390, 397, 407], "ieee": [390, 427], "transact": 390, "evolutionari": [390, 392, 394, 427, 437, 446], "182": 390, "197": 390, "april": [390, 422, 423, 427, 430], "2002": [390, 451], "1109": [390, 427], "4235": 390, "996017": 390, "gfsc22": 390, "matter": [13, 390, 405, 412, 415], "practic": [13, 390, 405, 412, 415], "thirti": [390, 454], "sixth": 390, "confer": [390, 412, 415, 427, 450, 454], "openreview": [390, 405, 412, 415, 443], "net": [390, 405, 412, 415, 443], "forum": [390, 405, 412, 415, 443], "yczrdi0y7g": [390, 405, 412, 415], "gost": 390, "22": [390, 396], "dockstr": [390, 391, 394, 399, 436, 440, 441], "gpb": 390, "jacob": [390, 427, 456], "gardner": [390, 444, 456], "geoff": 390, "pleiss": 390, "david": [390, 446, 452, 454, 456], "bindel": 390, "kilian": 390, "weinberg": 390, "gpytorch": [390, 444], "blackbox": 390, "matrix": [390, 446], "infer": 390, "gpu": 390, "2018": [220, 229, 390, 412, 415, 427, 442, 443, 444, 448, 454, 456], "gbwd": 390, "rafael": 390, "bombarelli": [390, 442, 443, 444, 448, 454, 456], "jennif": 390, "wei": 390, "duvenaud": 390, "benjam\u00edn": 390, "s\u00e1nchez": 390, "lengel": [390, 424], "denni": 390, "sheberla": 390, "jorg": 390, "aguilera": 390, "iparraguirr": 390, "timothi": 390, "hirzel": 390, "ryan": [390, 456], "adam": [390, 427], "al\u00e1n": [390, 424], "driven": 390, "central": 390, "268": 390, "276": 390, "februari": 390, "acscentsci": 390, "7b00572": 390, "ho96": 390, "hansen": [390, 446], "ostermei": [390, 446], "arbitrari": 390, "evolut": [390, 451], "strategi": [390, 394, 446], "covari": [390, 446], "312": 390, "317": 390, "1996": [390, 446], "icec": 390, "542381": 390, "hfg": 390, "21": [390, 436, 440], "machin": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 450], "drug": [220, 229, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 440], "discoveri": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "develop": [390, 391, 392, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 437, 443], "fifth": [], "2021": [390, 398, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 454], "8nvgnornowr": [], "jrhernandezgarcia": 390, "moksh": 390, "jain": [390, 395], "sharath": 390, "chandra": 390, "raparthi": 390, "alex": [390, 424], "hern": 390, "\u00e1": 390, "ndez": 390, "garc": 390, "\u0131": 390, "jarrid": 390, "rector": 390, "brook": 390, "yoshua": 390, "santiago": 390, "miret": 390, "emmanuel": 390, "gf": 390, "low": [21, 390], "kraus": [390, 450], "emma": 390, "brunskil": 390, "kyunghyun": [390, 407], "cho": [146, 390, 407], "barbara": 390, "engelhardt": 390, "sivan": 390, "sabato": 390, "jonathan": 390, "scarlett": 390, "40th": 390, "202": 390, "14631": 390, "14653": 390, "pmlr": [390, 412, 415, 450, 454], "29": 390, "jul": [390, 409, 410, 411, 412, 415], "mlr": [390, 450, 454], "press": [390, 450, 454], "v202": 390, "jain23a": 390, "kmh": 390, "19": 390, "johann": [390, 450], "kirschner": [390, 450], "mojmir": [390, 450], "mutni": [390, 450], "nicol": [390, 450], "hiller": [390, 450], "rasmu": [390, 450], "ischebeck": [390, 450], "safe": [390, 450], "high": [21, 390, 394, 442, 445, 448, 450, 454], "subspac": [390, 394, 450], "36th": [390, 450], "3429": [390, 450], "3438": [390, 450], "2019": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 399, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 450, 456], "v97": [390, 450], "kirschner19a": [390, 450], "ssw": 390, "16": [390, 396, 443], "bobak": 390, "shahriari": [390, 442, 443, 444, 448, 454, 456], "kevin": 390, "swerski": 390, "ziyu": 390, "wang": 390, "nando": 390, "freita": 390, "human": [390, 442, 443, 444, 448, 454, 456], "out": [390, 392, 398, 400, 401, 402, 403, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 430, 431, 432, 433, 434, 440, 442, 443, 444, 448, 454, 456], "review": 390, "104": 390, "148": 390, "175": 390, "januari": 390, "jproc": 390, "2494218": 390, "sr73": 390, "shrake": [390, 396], "ruplei": [390, 396], "exposur": 390, "atom": 390, "lysozym": 390, "insulin": 390, "79": [274, 390], "351": 390, "371": 390, "sep": [390, 405], "1973": [390, 396], "1016": 390, "0022": 390, "2836": 390, "73": 390, "90011": 390, "smg": 390, "preprint": [146, 390, 407, 409, 410, 411, 420], "blankdeb20": 390, "blank": [390, 451], "pymoo": [390, 451], "89497": 390, "89509": 390, "tutori": [391, 396, 436, 438, 442, 443, 444, 448, 454, 456], "cover": 391, "what": [391, 397, 413, 414, 426, 434, 436], "look": [391, 392, 437], "poli": [391, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "live": [391, 441], "goe": [391, 396], "exactli": [391, 392, 409, 420, 437], "doesn": [391, 438, 441], "mani": [11, 146, 391, 407, 451], "think": 391, "project": [93, 391, 396], "ll": [391, 395, 396, 440], "carri": 391, "let": [391, 393, 396, 427, 436, 438, 440, 441], "super_mario_bro": [391, 436, 440], "pt": [391, 397], "level_util": 391, "md": 391, "As": [391, 396, 436, 441], "don": [391, 392, 394, 404, 441], "end": [391, 396, 427, 438], "ignor": 391, "altern": [146, 391, 407], "averag": 391, "abstract_black_box": 391, "abstract_problem_factori": 391, "problem_setup_inform": 438, "pythonpath": [], "runtim": 391, "imagin": [], "your_local_depend": [], "yourblackbox": [], "your_arg": 391, "your_second_arg": 391, "your_kwarg": 391, "yourproblemfactori": [], "chapter": [392, 393, 394, 396, 437, 438, 440], "your_problem": 391, "problem_info": [428, 440], "__name__": 391, "__main__": 391, "registri": 391, "register_problem": [], "your_problem_factori": [], "your_env": 391, "That": [391, 409], "camel_cas": 391, "under": [391, 393, 395, 406, 430], "tell": 391, "though": 391, "sai": [391, 396, 430, 436, 441], "channel": [391, 392], "machinelearninglifesci": [391, 392, 393, 394, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "dev": [391, 392, 393, 394, 396], "java": 391, "poli__mario": 391, "forg": 391, "pytorch": 391, "openjdk": 391, "cpuonli": 391, "click": [391, 394, 399, 440], "moreov": [391, 392, 437, 454], "googl": [391, 394], "colab": [391, 394], "put": [391, 396, 451], "describ": [11, 391, 396, 409, 440, 442, 443, 448, 456], "register": [], "get_problem": [436, 440], "your_arg_1": 391, "mayb": 391, "your_arg_2": 391, "your_factori": 391, "thereof": [], "At": [21, 396, 438, 440], "point": [391, 392, 396, 438, 440, 444], "wrote": [], "direct": 450, "life": 397, "debug": [393, 428], "vscode": [], "available_problem_factori": 391, "importerror": [], "share": [391, 392, 393], "feel": [391, 392, 396], "contribut": [390, 391, 424, 440], "case": [392, 393, 396, 400, 428, 430, 433, 436, 437, 438, 440], "poli_baselin": [392, 393, 436, 440, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "almost": [392, 437], "trivial": [392, 393, 437, 440], "complic": [392, 437, 441], "likewis": [392, 437], "explain": [392, 437, 438], "abstractsolv": [392, 436, 437], "abstract_solv": [392, 436, 437], "black_box": [392, 393, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "histori": [392, 436, 437, 453, 455], "x0_i": 392, "y0_i": 392, "ingredi": [392, 396, 436, 437], "next_candid": [392, 436, 437], "propos": [146, 399, 407, 437, 440, 454], "solv": [392, 427, 436, 437, 440, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "max_it": [392, 436, 437, 440, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "next": [392, 394, 396, 436, 437, 438, 440], "solut": [392, 407, 422, 437, 451], "notimplementederror": [392, 437], "subclass": [391, 437], "100": [392, 437, 440, 451, 453, 455], "rang": [146, 392, 393, 407, 433, 437], "callback": [], "pre_step_callback": [], "turn": 454, "updat": [392, 436, 438, 440, 446], "_": [391, 392, 393, 451], "post": [], "post_step_callback": [], "get_best_perform": 436, "break_at_perform": [], "break": [], "leverag": [392, 437], "fact": [392, 437], "simplest": [392, 436, 437], "random_mut": [392, 436, 437, 440], "len": [392, 437], "best_x": [392, 437], "argmax": [392, 437], "alwai": [392, 400, 430, 433, 437, 441], "next_x": [392, 437], "po": [392, 437], "randint": [392, 437], "choic": [392, 437, 451], "pretti": [392, 396, 437], "lean": [392, 437], "notic": [392, 420, 437, 438], "sort": [392, 428, 437, 451], "logic": [6, 391, 392, 437, 438, 441], "noth": [53, 392, 436, 437], "worri": [391, 392, 394, 437], "slightli": [392, 437], "unfortun": [393, 404], "linux": [393, 404, 441], "maco": [393, 404], "top": [393, 394, 440], "therefor": [393, 441], "anaconda": 393, "went": 393, "okai": [393, 397], "anoth": [393, 396, 436, 440], "right": [391, 393, 438, 441], "bleed": 393, "edg": 393, "while": [128, 301, 393, 436], "stabl": [393, 436, 440], "releas": [393, 396], "shell": [391, 393], "home": [393, 395, 396, 409, 410, 411], "poli_object": [391, 393, 397], "phase": 393, "short": [393, 396], "futur": [393, 396], "everyth": [392, 393, 395, 438], "requisit": 393, "openbabel": [393, 404], "white_nois": [393, 433, 436, 440], "minimal_working_exampl": 393, "plenti": 393, "complex": [6, 390, 391, 392, 393, 396, 424], "rasp": [394, 397, 399, 436, 440], "pytdc": 394, "accces": 394, "featur": [394, 397], "clash": [394, 396], "discuss": [394, 438, 440], "baselin": [394, 436, 438, 440, 441, 442, 443, 444, 445, 448, 451, 452, 454, 456], "place": [394, 395, 396], "fresh": 394, "full": [394, 396], "drawn": [394, 399], "unit": [394, 399], "word": [394, 399, 427], "spell": [394, 399], "3pbl": [394, 399, 406], "implmenet": [], "fluoresc": [394, 396, 399, 436], "On": 394, "focus": 394, "cma": 394, "es": 394, "vanilla": [390, 394], "acquisit": [394, 444, 450], "over": [390, 394, 452], "encourag": 454, "gonzalezduquebartelsmichael": [], "2024": [146, 390, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "gonz\u00e1lez": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "duqu": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "bartel": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "simon": [390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "michael": [390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "richard": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "month": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "jan": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "titl": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "libari": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "year": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "drd3_dock": [436, 440], "graff": [], "shakhnovich": [], "foldx_": [], "gfp_cba": [436, 440], "park": [], "listgarten": [], "gfp_select": [436, 440], "penalized_logp_lambo": [436, 440], "rdkit_": [], "rfp_foldx_": [], "sa_tdc": [436, 440], "ertl": [390, 424], "schuffenhau": [390, 424], "volz": [390, 427], "toy_continuous_problem": [393, 436, 440, 443], "2013": [390, 430], "coupl": [392, 394], "guid": [394, 440], "subset": [395, 430, 446], "suit": [13, 380, 391, 395], "thing": [391, 395, 396, 441], "dg": 395, "metric": [301, 395], "recent": 395, "academ": 395, "licens": 395, "zip": 395, "auxiliari": 395, "renam": [395, 396, 409, 410, 411], "help": 395, "mac": [395, 441], "warn": [395, 441], "unverifi": 395, "quarantin": 395, "command": [395, 396, 410, 411], "own": [6, 391, 392, 395], "risk": 395, "xattr": 395, "appl": 395, "familiar": 396, "ourselv": 396, "alreadi": [396, 436, 440], "refresh": 396, "essenti": [396, 438], "notebook": 396, "pathlib": [396, 397, 409, 410, 411, 436, 438], "shutil": 396, "path_to_foldx_fil": 396, "this_dir": [396, 438], "resolv": [396, 436, 438], "tmp": 396, "mkdir": [396, 438], "copyfil": 396, "respons": 396, "transport": 396, "oxigen": 396, "sperm": 396, "whale": 396, "101m": 396, "hand": 396, "urllib": 396, "web_address": 396, "rcsb": 396, "urlretriev": 396, "Of": [396, 440], "cours": [301, 396, 440], "long": [146, 396, 407, 436], "aid": [271, 274, 396], "pdb_name": 396, "choos": [396, 440], "repairpdb": [396, 410, 411], "littl": 396, "consumig": 396, "400sec": 396, "build": [396, 440, 444], "101m_repair": 396, "repair_cmd": 396, "water": [396, 410, 411, 422], "crystal": [396, 410, 411], "tree": 396, "fxout": 396, "unrecognized_molecul": 396, "onward": [396, 444], "inspect": 396, "parser": 396, "get_residu": 396, "dive": [6, 396, 440], "first_residu": 396, "resnam": 396, "index": 396, "get_par": 396, "met": 396, "extract": 396, "sequtil": 396, "seq1": 396, "original_residu": 396, "chain_id": 396, "position_in_sequ": 396, "mutant_residu": 396, "glycin": 396, "Be": [396, 397], "care": [396, 436, 441], "fire": 396, "did": 396, "modifi": [391, 396], "mutation_list": 396, "residue_idx": 396, "li": [220, 229, 390, 396, 412, 415], "tranform": 396, "position_in_chain": 396, "content": [390, 396], "indiviual_list": 396, "ma0g": 396, "won": [396, 427], "buildmodel": 396, "gibb": 396, "foldx_cmd": 396, "consortium": 396, "jesper": [396, 409, 410, 411], "freder": [396, 409, 410, 411], "joost": [396, 409, 410, 411], "lui": [396, 409, 410, 411], "peter": [390, 396, 424], "vanhe": 396, "erik": [390, 396, 448], "verschueren": 396, "baeten": 396, "javier": 396, "delgado": 396, "francoi": [396, 409, 410, 411], "permut": 396, "concept": 396, "raphael": 396, "gueroi": 396, "backhbond": 396, "142": 396, "58": 396, "sidehbond": 396, "48": [137, 390, 396, 405], "61": 396, "energy_vdw": 396, "179": 396, "63": 396, "electro": 396, "energy_solvp": 396, "245": 396, "28": [396, 427], "energy_solvh": 396, "238": 396, "89": 396, "energy_vdwclash": 396, "42": 396, "energy_tors": 396, "70": 396, "backbone_vdwclash": 396, "158": 396, "entropy_sidec": 396, "105": 396, "87": 396, "entropy_mainc": 396, "231": 396, "69": 396, "bond": 396, "00": 396, "helix": 396, "dipol": 396, "75": 396, "loop_entropi": 396, "cis_bond": 396, "disulfid": 396, "kn": 396, "electrostat": 396, "partial": 396, "coval": 396, "energy_ionis": 396, "56": 396, "entropi": 396, "32": [390, 396, 456], "meta0": 396, "gly": 396, "ok": 396, "wed": 396, "feb": [396, 448], "44": 396, "52": 396, "spend": 396, "96": 396, "valid": 396, "101m_repair_1": 396, "successfulli": 396, "completedprocess": 396, "sjt972": [93, 396, 436, 440, 441], "understanding_foldx": 396, "01": [396, 415], "returncod": 396, "average_101m_repair": 396, "dif_101m_repair": 396, "pdblist_101m_repair": 396, "raw_101m_repair": 396, "wt_101m_repair_1": 396, "raw_": 396, "_repair": [396, 410, 411], "tabl": 396, "quantiti": 396, "column_nam": 396, "backbon": 396, "hbond": 396, "sidechain": 396, "van": 396, "der": 396, "waal": 396, "solvat": 396, "polar": 396, "hydrophob": 396, "mainchain": 396, "sloop_entropi": 396, "mloop_entropi": 396, "torsion": 396, "bridg": 396, "kon": 396, "ionis": 396, "pd": 396, "readlin": 396, "df": 396, "split": 396, "column": 396, "var": 396, "l3": 396, "qk9dx6g958765kmn_2wn34t00000gn": 396, "ipykernel_25734": 396, "1758354106": 396, "deprecationwarn": 396, "pyarrow": 396, "major": 396, "arrow": 396, "interoper": 396, "caus": 396, "pleas": [396, 436, 440, 441], "issu": [396, 409, 410, 411], "54466": 396, "overal": 396, "31": 396, "7457": 396, "34": [396, 413], "3436": 396, "notat": 396, "stand": [13, 396, 440], "again": 396, "wt_structur": 396, "mut_structur": 396, "pdb1": 396, "shrakeruplei": 396, "attach": [396, 438], "8407": 396, "731560227876": 396, "8439": 396, "063468009845": 396, "impact": 396, "databas": 396, "desir": [396, 440], "lesser": 396, "stabler": 396, "correl": 396, "present": [146, 396, 407], "supervis": 397, "approach": 397, "network": [390, 397, 427, 442, 443, 444, 448, 454, 456], "drawback": 397, "similar": [115, 128, 238, 394, 397, 399, 403, 425], "foldx_stabl": [397, 436, 440], "awar": [397, 444], "scale": [220, 229, 397, 430, 448], "easier": 397, "poli__rasp": 397, "correct": 428, "breakpoint": [], "satisfi": [], "root": 409, "3ned": [397, 436], "__file__": 397, "wildtype_pdb_paths_for_rasp": [], "f_rasp": [], "wildtype_str": [], "join": 436, "three": [438, 440], "three_mut": [], "wildtype_sequ": [], "ddg": [], "approx": [], "03": [390, 412, 427], "07": [], "clang": 397, "cmake": 397, "reduc": 397, "pin": 397, "hash": [390, 397, 442, 456], "bd23a0bf627ae9b08842102a5c2e9404b4a81924": 397, "cavity_model_15": 397, "ds_model": 397, "3ccebe87e017b6bd737f88e1943557d128c85616": 397, "against": [397, 404], "checksum": 397, "satur": 397, "mutagenesi": 397, "pmo": [13, 399, 405, 412, 415], "jump": [301, 399], "cap": 400, "prepar": 404, "autodock": 404, "vina": 404, "suppos": 404, "batteri": 404, "even": 404, "poli__dockstr": 441, "canon": 406, "risperidon": [404, 441], "dockstringproblemfactori": 404, "drd2": [137, 394, 399, 404, 441], "risperidone_smil": [], "cc1": [404, 441], "n2ccccc2": [404, 441], "n1": [404, 441], "ccn3ccc": [404, 441], "cc3": [398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 441], "c4": [404, 441], "noc5": [404, 441], "c4c": [404, 441], "c5": [404, 441], "handl": [392, 441], "hood": 406, "abov": [406, 409], "success": 406, "underneath": 409, "poli__tdc": [], "text": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "foldx_rfp_lambo": [409, 436, 440], "poli__lambo": 409, "avali": 409, "skip": 409, "decid": 409, "11189": 409, "00587946": 409, "8155": 409, "acces": [410, 424], "foldx_stability_and_sasa": [410, 411, 436, 440], "v4": [410, 411], "filenam": [410, 411], "cach": [410, 411], "your_fil": [410, 411], "heteroatom": [410, 411], "pdbtool": [410, 411], "Then": [], "foldx_sasa": [436, 440], "poli__protein": 441, "carefulli": 420, "zinc": 420, "coeffici": 422, "octanol": 422, "rdkit_logp": [436, 440], "carbon": [420, 422, 423], "6361": 422, "rdkit_q": [436, 440, 445, 452], "35978494": [], "assert": [], "isclos": [], "8548": [], "run_info": 428, "link": 428, "peopl": [220, 229, 430], "sum_": 430, "x_d": 430, "saasbo": [394, 430], "assumpt": 430, "roughli": 430, "speak": 430, "question": [427, 430], "30d": 430, "dimensions_to_embed_in": [325, 328, 430], "mathcal": 433, "But": 435, "idea": 435, "rc": [], "sit": [], "rfp_foldx_stability_and_sasa": [436, 440], "stick": 436, "red": 436, "explor": [436, 444], "ls": 436, "3ned_repair": 436, "optimizing_protein_st": 436, "ipynb": 436, "mrogu": 436, "hopefulli": [], "remind": [], "forgot": [], "traceback": [], "138": [], "typeerror": [], "got": [], "unexpect": [], "176": [], "145": [], "cell": [], "439": [], "437": [], "438": [], "__create_as_isolated_process": [], "440": [], "441": [], "442": [], "443": [], "444": [], "445": [], "446": [], "447": [], "448": [], "449": [], "problem_inform": [], "451": [], "278": [], "tb": [], "msg": [], "277": [], "279": [], "280": [], "281": [], "msg_type": [], "282": [], "five": [], "section": 436, "select": [436, 450], "alter": 436, "special": [392, 436, 440], "n_iter": 436, "178": [], "76": [], "267": [], "80": [], "13": [], "374": [], "65": [], "17": [], "146": [], "340": [], "27": 390, "77": 441, "41": [], "na194f": [], "asna194": [], "193": [], "phe": [], "fri": [], "09": [], "51": [], "54": [271, 274], "3ned_repair_1": [], "qa114": [], "glna114": [], "113": [], "ser": [], "da3m": [], "aspa3": [], "kei": [393, 436], "get_best_solut": [436, 440, 451, 453, 455], "41639": [], "0629": [], "5983": [], "1298": [], "eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslsdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgemkmrlklkdgghydaevkttykakkpvqlpgayftntklditshnedytiveqyernegrhstggmdelyk": [], "appli": 437, "part": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 427, 429, 431, 432, 434, 438, 440, 441], "compar": [394, 438, 441], "qualiti": 438, "save": 438, "json": 438, "mlflow": 438, "weight": 438, "bias": 438, "abstract_observ": 438, "skeleton": 438, "simpleobserv": 438, "init": 438, "servic": 438, "wandb": 438, "adjac": 438, "identifi": 438, "uuid4": 438, "metadata": 438, "uuid": 438, "experiment_path": 438, "as_dict": 438, "recal": 438, "tolist": 438, "dump": 438, "curiou": 438, "rememb": 438, "invent": 438, "wheel": 438, "tensorboard": 438, "fp": 438, "snippet": 438, "scenario": 438, "z": [220, 229, 438], "were": [146, 407, 438, 441], "accordingli": 438, "migu": 438, "flea": 438, "showcas": 438, "behind": 438, "saw": 438, "overwritten": 438, "deeper": [6, 440], "intro": 440, "treat": [115, 397, 440], "anyth": [], "further": [], "page": [390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 440, 442, 450, 454], "randommut": [440, 453, 455], "anaconda3": [436, 440, 441], "docs2": [436, 440], "lib": [436, 440, 441], "python3": [436, 440, 441], "tqdm": [436, 440], "auto": [436, 440], "tqdmwarn": [436, 440], "iprogress": [436, 440], "jupyt": [436, 440], "ipywidget": [436, 440], "readthedoc": [436, 440], "io": [436, 440], "user_instal": [436, 440], "autonotebook": [436, 440], "notebook_tqdm": [436, 440], "16173153": [], "dtype": [], "u1": [], "talk": 440, "babel": 441, "No": [441, 454], "freez": 441, "grep": 441, "135": [], "dynamically_instanti": [], "102": [], "92": [], "exec": [], "modulenotfounderror": [], "critic": [], "opt": [], "homebrew": [], "condabin": [], "autodock_vina_1_1_2_mac_catalina_64bit": [], "usr": [], "cryptex": [], "app": [], "sbin": [], "cryptexd": [], "codex": [], "bootstrap": [], "appleintern": [], "tex": [], "texbin": [], "cargo": [], "using_poli": [], "the_bas": [], "python39": [], "dynload": [], "externalblackbox": [], "num_evalu": [], "dockstringwarn": 441, "although": 441, "perfectli": 441, "match": [392, 441], "platform": [424, 441], "report": [413, 414, 426, 434, 441], "f_logp": [], "x0_logp": [], "y0_logp": [], "logpblackbox": 422, "combin": [], "optimizing_aloha": [], "01_a_simple_example_of_optim": [], "our_aloha": [], "past": 391, "haven": [], "realli": [], "Its": [], "summari": [], "less": [], "conclud": [], "takeawai": [], "independ": [], "why": [], "registering_aloha": [], "search": 444, "aloof": [], "syntax": [], "ouralohablackbox": [], "sum": [], "axi": [390, 394], "keepdim": [], "get_max_sequence_length": [], "x_0": [], "alohablackbox": 400, "ascii_uppercas": [], "ouralohaproblemfactori": [], "interpret": [220, 229, 390, 412, 415], "poli_aloha": [], "poli_aloha_problem": [], "yourself": [], "aloha_problem_factori": [], "somewher": [], "workhors": [], "querying_aloha": [], "emphas": [], "amaz": [], "x1": [], "y1": [], "subtl": [], "cheminformat": [137, 220, 229, 390, 405, 412, 415, 422, 423, 424], "mechan": [], "solver": [442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "approxim": 444, "tild": 444, "boldsymbol": [444, 446], "surrog": 444, "render": [427, 444], "smartli": 444, "balanc": 444, "exploit": 444, "grid": 444, "vanillabayesianoptim": 444, "f_acklei": [442, 444, 448, 454, 456], "randn": [442, 444, 448, 450, 454, 456], "clip": [442, 444, 448, 450, 454, 456], "bo_solv": [442, 444, 448, 454, 456], "great": [390, 442, 443, 444, 448, 454, 456], "mostli": [442, 443, 444, 448, 454, 456], "intent": [442, 443, 444, 448, 454, 456], "adversari": [390, 427, 442, 443, 444, 448, 454, 456], "gan": [442, 443, 444, 448, 454, 456], "maintain": [6, 446], "mu": 446, "sigma": 446, "member": 446, "introduct": 446, "blogpost": 446, "pycma": 446, "cma_e": 446, "toycontinuousproblemfactori": 430, "population_s": [446, 450, 451], "initial_mean": 446, "initial_sigma": 446, "restrict": 450, "coordin": 450, "singletaskgp": 450, "type_of_lin": 450, "non": [146, 407, 451], "domin": 451, "mate": 451, "procedur": [390, 451], "upon": 451, "alohaproblemfactori": [392, 400, 451, 453, 455], "multi_objective_black_box": 451, "multiobjectiveblackbox": 451, "discretensgaii": 451, "hyperparamet": 451, "max_iter": 451, "num_mut": 451, "f_aloha": 451, "togeth": 451, "popul": 451, "56267": [], "846902": [], "39441": [], "eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgemkmrlklkdgghydaevkttykakkpvqlpgayntntklditshnedytiveqyernegrhstggmdelyk": [], "258": [], "userwarn": [], "Will": [], "env_nam": [], "269": [], "compat": 6, "abstractisolatedfunct": [6, 391, 441], "externalfunct": 6, "external_isolated_function_script": 6, "properti": 11, "fix": [11, 391, 407], "fidel": [21, 438], "noisi": 21, "etc": [21, 427], "black_box_inform": [391, 438], "blackboxinform": [26, 391, 433, 436, 438, 440], "abstractproblem": 109, "plan": [14, 142, 279, 427], "elbo": 210, "n_starting_point": 210, "playabl": 301, "checklist": 391, "pai": 391, "attent": 391, "my_problem_nam": 391, "desc": 391, "boilerpl": 391, "my_problem_inform": 391, "fixed_length": [391, 433, 438, 440], "determinist": [391, 433, 436, 438], "potenti": 391, "padding_token": [391, 433, 438], "entri": 391, "rout": 391, "whatev": 391, "one_depend": 391, "another_depend": 391, "yet_another_depend": 391, "complicatedclass": 391, "abstract_isolated_funct": 391, "myisolatedlog": 391, "register_isolated_funct": 391, "my_problem_name__isol": 391, "__isol": 391, "conda_env_inside_environment_fil": 391, "instance_function_as_isolated_process": 391, "my_problem_info": 391, "myblackbox": 391, "my_problem": [], "inner_funct": [391, 441], "weren": [], "problem_name__isol": [], "static": 391, "staticmethod": 391, "get_black_box_info": 391, "myproblemfactori": 391, "my_problem_factori": [], "available_black_box": [391, 393], "dict_kei": 393, "whitenoiseblackbox": [433, 440], "08390547": [], "properli": 436, "foldxstabilityproblemfactori": [411, 436], "foldxstabilityblackbox": [411, 436], "46959": 436, "4687": 436, "14886": 436, "56841": 436, "eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgimkmrlklkdgghydaevkttykakkpvqlpgayntntklditshnedytiveqyernegrhstggmdelyk": 436, "dockstringblackbox": [404, 441], "submodul": 441, "multiprocess": 441, "qedproblemfactori": 423, "qedblackbox": 423, "35978": 423, "toycontinuousblackbox": [430, 442, 444, 446, 448, 450, 454, 456], "whitenoiseproblemfactori": 433, "logpproblemfactori": 422, "drd3problemfactori": 406, "drd3blackbox": 406, "c1ccccc1": 406, "penalizedlogplamboproblemfactori": 420, "penalizedlogplamboblackbox": 420, "2238": 420, "saproblemfactori": 424, "sablackbox": 424, "ccnc": 424, "c1ccc": 424, "nc": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "n2cc": 424, "c2": 424, "c1": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "85483733": 424, "wildtype_repair": [410, 411], "foldxsasaproblemfactori": 410, "foldxsasablackbox": 410, "raspblackbox": 397, "raspproblemfactori": 397, "static_files_for_test": [], "ssmnonv16": 390, "jame": 390, "summervil": [390, 427], "sam": 390, "snodgrass": 390, "matea": 390, "onta": 390, "villar": 390, "vglc": 390, "video": 390, "game": [390, 427], "corpu": 390, "7th": 390, "workshop": 390, "tkb10": 390, "togeliu": [390, 427], "sergei": [390, 424, 427], "karakovskii": [390, 427], "robin": [390, 427], "baumgarten": [390, 427], "ai": [390, 427], "competit": [146, 390, 407, 427], "congress": [390, 427], "2010": [390, 427], "cec": [390, 427], "5586133": [390, 427], "classic": 427, "floor": 427, "pipe": [392, 427], "enemi": 427, "action": 427, "constrain": 427, "constraint": 427, "frame": 427, "buffer": 427, "screen": 427, "dropwdown": [], "hpc": 427, "cluster": [], "docker": 427, "xvfb": 427, "99": 427, "1024x768x24": 427, "extens": 427, "glx": 427, "noreset": 427, "background": 427, "marioai": 427, "supermariobrosblackbox": 427, "supermariobrosproblemfactori": 427, "visual": 427, "kha09": 390, "ahm": [390, 427], "khalifa": [390, 427], "amidos2006": [390, 427], "vl": 390, "vanessa": [390, 427], "luca": [390, 427], "schrum": [390, 427], "smith": [390, 427], "jialin": [390, 427], "liu": [220, 229, 390, 412, 415, 427], "sebastian": [390, 427], "risi": [390, 427], "evolv": [390, 427], "gecco": [390, 427], "221": [390, 427], "228": [390, 427], "1145": [390, 427], "3205455": [390, 427], "3205517": [390, 427], "extend": [13, 399], "guacamol": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 394, 398, 399, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "2206": 13, "12411": 13, "novo": [13, 115, 122, 125, 128, 137, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "59": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "pub": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341], "8b00839": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "tdcisolatedfunct": 15, "tdc__isol": 15, "albuterol": [115, 394, 399], "consist": [115, 125, 128, 238, 304, 331], "medicin": 115, "breath": 115, "difficulti": 115, "symptom": 115, "cite": [115, 122, 125, 128, 137, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 442, 443, 445, 448, 450, 452, 454, 456], "amlodipin": [122, 394, 399], "mpo": [122, 149, 241, 250, 253, 286, 341, 394, 399], "celecoxib": [125, 394, 399], "rediscoveri": [125, 304, 331, 394, 399], "rediscov": [125, 304, 331], "decor": [128, 394, 399], "hop": [128, 283, 394, 399], "exclud": 128, "smart": [128, 334, 394, 399], "classifi": [137, 415], "olivecrona": [137, 390, 405], "bioactiv": 137, "dopamin": [137, 405], "receptor": [137, 405], "reinforc": [137, 390, 405], "jcheminf": 137, "biomedcentr": 137, "articl": [137, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 431, 432, 434, 448], "1186": [137, 390, 405, 412, 415, 424], "s13321": [137, 390, 405, 412, 415], "017": [137, 390, 405], "0235": [137, 390, 405], "fexofenadin": [149, 394, 399], "glycogen": 220, "synthas": 220, "kinas": 220, "beta": 220, "gsk3beta": 220, "condit": [220, 229, 390, 392, 407, 412, 415], "graph": [220, 229, 390, 412, 415], "zhang": [220, 229, 390, 412, 415], "substructur": [220, 229, 390, 412, 415], "jin": [220, 229, 390, 412, 415], "wengong": [220, 229, 390, 412, 415], "regina": [220, 229, 390, 412, 415], "barzilai": [220, 229, 390, 412, 415], "tommi": [220, 229, 390, 412, 415], "jaakkola": [220, 229, 390, 412, 415], "icml": [220, 229], "csail": [220, 229], "mit": [220, 229], "jbj_icml2020b": [220, 229], "excap": [220, 229, 415], "db": [220, 229, 415], "integr": [220, 229], "larg": [220, 229], "facilit": [220, 229], "big": [220, 229], "analysi": [220, 229, 271, 274], "chemogenom": [220, 229], "jiangm": [220, 229], "isom": [223, 226, 394, 399], "c7h8n2o2": [223, 394, 399], "c9h10n2o2pf2cl": [226, 394, 399], "median": [232, 235, 394, 399], "mestranol": [238, 394, 399], "osimetrinib": [241, 394, 399], "perindopril": 250, "ranolazin": [253, 394, 399], "scaffold": [283, 394, 399], "sitagliptin": [286, 394, 399], "thiothixen": [304, 394, 399], "effect": [325, 442], "branin_2d": 328, "troglitazon": [331, 394, 399], "valsartan": [334, 394, 399], "zaleplon": [341, 394, 399], "famili": [398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 434], "albuterolsimilarityproblemfactori": 398, "albuterolsimilarityblackbox": 398, "1ccc2c": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "sc": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "coc3ccc": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "cl": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "c2c": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "2772277": 398, "resourc": [397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "nathan": [390, 398, 401, 402, 403, 407, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "marco": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "fiscato": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "marwin": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "segler": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "alain": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "vaucher": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "march": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1096": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1108": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "bibtex": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "issn": [397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 450, 454], "1549": [398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "9596": [398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "960x": [398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "mar": [398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "languag": [398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 443, 450, 454], "gonzalez": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 450, 452, 454, 456], "forest": [405, 412, 415], "classif": [405, 412], "drd2problemfactori": 405, "drd2blackbox": 405, "001546": 405, "marcu": [390, 405], "thoma": [390, 405], "blaschk": [390, 405], "ola": [390, 405], "engkvist": [390, 405], "hongm": [390, 405, 424], "chen": [390, 405, 424], "septemb": [390, 405], "denovorl": 405, "1758": [390, 405, 412, 415, 424], "2946": [390, 405, 412, 415, 424], "bfsv19": 390, "obec17": 390, "yibo": [390, 412, 415], "liangren": [390, 412, 415], "zhenm": [390, 412, 415], "24": [390, 412, 415], "018": [390, 412, 415], "0287": [390, 412, 415], "37": [390, 412, 415], "th": [390, 412, 415], "119": [412, 415], "mocondit": [412, 415], "mointerpret": [412, 415], "jbj20": 390, "lzl18": 390, "gsk3\u03b2": [394, 399], "gsk3betaproblemfactori": 412, "gsk3betablackbox": 412, "es09": 390, "ansgar": [390, 424], "fragment": [390, 424], "june": [390, 424], "pzsl": 390, "miss": 390, "polykovskii": [390, 424], "mose": [390, 424], "daniil": 424, "alexand": 424, "zhebrak": 424, "sanchez": 424, "golovanov": 424, "oktai": 424, "tatanov": 424, "stanislav": 424, "belyaev": 424, "rauf": 424, "kurbanov": 424, "frontier": 424, "pharmacolog": 424, "frontiersin": 424, "3389": 424, "fphar": 424, "565644": 424, "jun": [405, 412, 424], "1663": 424, "9812": 424, "artamonov": 424, "aleksei": 424, "aladinskii": 424, "vladimir": 424, "veselov": 424, "mark": 424, "kadurin": 424, "artur": 424, "nikolenko": 424, "zhavoronkov": 424, "mestranolsimilarityproblemfactori": 418, "mestranolsimilarityblackbox": 418, "19460881": 418, "toward": [402, 413, 414, 416, 417, 429, 431], "celecoxibrediscoveryproblemfactori": 402, "celecoxibrediscoveryblackbox": 402, "14728682": 402, "thiothixenerediscoveryproblemfactori": 429, "thiothixenerediscoveryblackbox": 429, "17391304": 429, "troglitazonerediscoveryproblemfactori": 431, "troglitazonerediscoveryblackbox": 431, "24427481": 431, "properi": [401, 408, 419, 421, 426, 434], "respect": [401, 408, 419, 421, 426, 434], "amlodipinempoproblemfactori": 401, "amlodipinempoblackbox": 401, "46108397": 401, "fexofenadinempoproblemfactori": 408, "fexofenadinempoblackbox": 408, "43364462": 408, "osimetrinibmpoproblemfactori": 419, "osimetrinibmpoblackbox": 419, "09011743": 419, "ranolazinempoproblemfactori": 421, "ranolazinempoblackbox": 421, "29285467": 421, "discrep": [413, 414, 426, 434], "sitagliptinmpoproblemfactori": 426, "sitagliptinmpoblackbox": 426, "34970668e": 426, "zaleplonmpoproblemfactori": 434, "zaleplonmpoblackbox": 434, "0019018": 434, "deco": [394, 399], "decohopproblemfactori": 403, "decohopblackbox": 403, "53383654": 403, "scaffoldhopproblemfactori": 425, "scaffoldhopblackbox": 425, "38446411": 425, "formula": [413, 414], "isomerc7h8n2o2problemfactori": 413, "isomerc7h8n2o2blackbox": 413, "19875911e": 413, "isomerc9h10n2o2pf2clproblemfactori": 414, "isomerc9h10n2o2pf2clblackbox": 414, "71390843e": 414, "median1problemfactori": 416, "median1blackbox": 416, "09722244": 416, "median2problemfactori": 417, "median2blackbox": 417, "1225969": 417, "valsartansmartsproblemfactori": 432, "valsartansmartsblackbox": 432, "terapeut": 415, "jnk3": [394, 399, 415, 440], "jnk3problemfactori": 415, "jnk3blackbox": 415, "rdk06": 390, "2006": [390, 422, 423], "sb13": 390, "04": [390, 430], "2050": 397, "084x": 397, "publish": [397, 422, 423, 442, 448, 450, 454, 456], "public": 397, "ltd": 397, "garciaortegon": 404, "aug": 404, "robbi": [409, 410, 411], "88": [409, 410, 411], "1093": [409, 410, 411], "nar": [409, 410, 411], "gki387": [409, 410, 411], "0305": [409, 410, 411], "1048": [409, 410, 411], "12th": [422, 423, 427], "misc": [407, 422, 423, 427, 430, 445], "howpublish": [422, 423, 427, 430], "displai": 427, "pp": [427, 450], "marioaiframework": 427, "inproceed": [405, 412, 415, 427, 442, 443, 450, 452, 454, 456], "marioaicompetit": 427, "booktitl": [390, 427, 442, 450, 452, 456], "9781450356183": 427, "continuous_objective_benchmark": 430, "address": 430, "institut": 430, "surjanovicbingham": 430, "test_funct": 430, "hartmann_6d": 328, "rosenbrock": 328, "levi": 328, "threefold": 448, "prior": [394, 448, 454], "lengthscal": [394, 448, 454], "improv": [394, 448], "outputscal": 448, "bayesian_optim": [442, 443, 445, 448, 452, 454, 456], "vanilla_bo_hvarfn": 448, "vanillabohvarfn": 448, "hvarfner": [390, 394], "hhn24": 390, "carl": [390, 448], "orm": [390, 448], "hellsten": [390, 448], "luigi": [390, 443, 445, 448], "nardi": [390, 443, 445, 448], "2402": [390, 448], "02229": [390, 448], "ej21": 390, "eriksson": [390, 394, 452, 454, 456], "martin": [390, 454], "jankowiak": [390, 394, 454], "spars": [390, 394], "cassio": 390, "campo": 390, "marlo": 390, "maathui": 390, "seventh": [390, 454], "161": 390, "493": [390, 454], "503": [390, 454], "v161": [390, 454], "eriksson21a": [390, 454], "ax": [394, 442, 448, 454], "saa": 454, "sparciti": 454, "fulli": 454, "treatment": 454, "nut": 454, "offici": [394, 445, 448, 452], "noise_std": [443, 448], "48550": 448, "vanillabo": 448, "erikssonjankowiak": 454, "2640": [450, 454], "3498": [450, 454], "dec": 454, "lcrb20": 390, "roberto": [390, 442], "calandra": [390, 442], "akshara": [390, 442], "rai": [390, 442], "examin": [390, 442], "linear": 390, "1546": [390, 442], "1558": [390, 442], "10fb6cfa4c990d2bad5ddef4f70e8ba2": [390, 442], "lower_dim": 442, "dim": 442, "global": [390, 456], "6c990b7aca7bc7058f5e98ea909e924b": [390, 456], "pearc": [390, 456], "turner": [390, 456], "poloczek": [390, 443, 445, 456], "matthia": [390, 443, 445, 456], "epg": 390, "pnp22": 390, "papenmei": [390, 394, 443, 445], "baxu": [390, 394], "uniform": 443, "n_init": 443, "increas": 443, "scope": 443, "nest": 443, "e4wf6112di": 443, "leonard": [390, 443, 445], "expand": 394, "pnp24": 390, "bounc": [390, 394], "reliabl": [390, 445], "combinatori": [390, 394, 445], "mix": [390, 445, 452], "2307": [390, 445], "00618": [390, 445], "increasingli": [394, 445], "fork": [392, 445, 452], "bouncesolv": 445, "load_your_alphabet": 445, "sequence_length": [407, 445, 452], "load_your_sequence_length": 445, "n_initial_point": [392, 445], "dwade": 390, "xingchen": [390, 452], "wan": [390, 452], "osborn": [390, 452], "probabilist": [390, 394], "reparameter": [390, 452], "35": [390, 452], "reparametr": 394, "probrep": [394, 452], "pr": [394, 452], "eprint": [407, 445], "archiveprefix": [407, 445], "primaryclass": [407, 445], "lg": [407, 445], "probabilisticreparametrizationsolv": 452, "load_alphabet": 452, "load_sequence_length": 452, "x0_": 452, "nop": 452, "impos": 392, "leav": 392, "x_i": 392, "y_i": 392, "reason": 392, "practition": 392, "quickli": 392, "stepbystepsolv": 392, "secondli": 392, "subfold": 392, "your_solver_nam": 392, "templat": 392, "poli__your_solver_nam": 392, "ideal": 392, "yoursolv": 392, "est": 392, "your_solv": 392, "poli__ax": [442, 448, 454], "poli__baxu": 443, "poli__bounc": 445, "poli__pr": 452, "NOT": 39, "prohibit": 40, "foldxstabilityandsasablackbox": [410, 411], "quick": [146, 407], "mind": [146, 407], "feasibl": [146, 407], "unfeas": [146, 407], "uninform": [146, 407], "motif": [146, 407], "within": [146, 407], "meant": [146, 397, 407], "alberstein": [146, 390, 407], "frei": [146, 390, 407], "watkin": [146, 390, 407], "biophys": [146, 390, 407], "2407": [146, 390, 407], "00236": [146, 390, 407], "rough": [271, 274], "mount": [271, 274], "fuji": [271, 274], "rmf": [271, 274], "fit": [271, 274], "tunabl": [271, 274], "rugged": 271, "neidhart": [271, 274], "ig": 271, "szendro": [271, 274], "krug": [271, 274], "rug": [271, 274], "2014": [271, 274], "1534": [271, 274], "114": [271, 274], "167668": [271, 274], "aita": [271, 274], "mt": [271, 274], "prolyl": [271, 274], "endopeptidas": [271, 274], "thermolysin": [271, 274], "biopolym": [271, 274], "2000": [271, 274], "1002": [271, 274], "sici": [271, 274], "1097": [271, 274], "0282": [271, 274], "200007": [271, 274], "64": [271, 274], "bip70": [271, 274], "co": [271, 274], "na": 274, "198": 274, "699": 274, "721": 274, "uchiyama": 274, "iii": 371, "promis": 380, "fulfil": 407, "ehrlichblackbox": 407, "ehrlichproblemfactori": 407, "256": 407, "motif_length": 407, "n_motif": 407, "quantiz": 407, "saf": 390, "robert": [390, 407], "ehrlich": [394, 440], "_only_": 407, "divis": 407, "processor": 407, "infinit": 407, "construct_optimal_solut": 407, "offset": 407, "construct_random_motif": 407, "construct_random_offset": 407, "iv": [], "albuterol_similar": 440, "amlodipine_mpo": 440, "celecoxib_rediscoveri": 440, "deco_hop": 440, "drd2_dock": 440, "fexofenadine_mpo": 440, "gsk3_beta": 440, "isomer_c7h8n2o2": 440, "isomer_c9h10n2o2pf2cl": 440, "median_1": 440, "median_2": 440, "mestranol_similar": 440, "osimetrinib_mpo": 440, "perindopril_mpo": 440, "ranolazine_mpo": 440, "rmf_landscap": 440, "scaffold_hop": 440, "sitagliptin_mpo": 440, "thiothixene_rediscoveri": 440, "troglitazone_rediscoveri": 440, "valsartan_smart": 440, "zaleplon_mpo": 440, "47139683": 440, "TO": 391, "get_inner_funct": 391, "isolated_function_nam": 391, "your_problem__isol": 391, "class_nam": 391, "module_to_import": 391, "other_kwargs_that_go_into_myisolatedlog": 391, "chains_to_keep": 397, "return_value_on_unfeas": 407}, "objects": {"": [[0, 0, 0, "-", "poli"]], "poli": [[1, 0, 0, "-", "core"], [107, 0, 0, "-", "objective_factory"], [112, 0, 0, "-", "objective_repository"], [343, 0, 0, "-", "tests"]], "poli.core": [[2, 0, 0, "-", "abstract_benchmark"], [3, 0, 0, "-", "abstract_black_box"], [6, 0, 0, "-", "abstract_isolated_function"], [7, 0, 0, "-", "abstract_problem_factory"], [10, 0, 0, "-", "benchmark_information"], [11, 0, 0, "-", "black_box_information"], [12, 0, 0, "-", "chemistry"], [16, 0, 0, "-", "exceptions"], [19, 0, 0, "-", "multi_objective_black_box"], [21, 0, 0, "-", "problem"], [24, 0, 0, "-", "proteins"], [28, 0, 0, "-", "registry"], [37, 0, 0, "-", "util"]], "poli.core.abstract_black_box": [[4, 1, 1, "", "AbstractBlackBox"], [5, 1, 1, "", "NegativeBlackBox"]], "poli.core.abstract_black_box.AbstractBlackBox": [[4, 2, 1, "", "__call__"], [4, 2, 1, "", "__del__"], [4, 2, 1, "", "__enter__"], [4, 2, 1, "", "__exit__"], [4, 2, 1, "", "__init__"], [4, 2, 1, "", "__neg__"], [4, 2, 1, "", "_black_box"], [4, 3, 1, "", "batch_size"], [4, 3, 1, "", "num_workers"], [4, 3, 1, "", "observer"], [4, 3, 1, "", "observer_info"], [4, 3, 1, "", "parallelize"], [4, 2, 1, "", "reset_evaluation_budget"], [4, 2, 1, "", "set_observer"], [4, 2, 1, "", "terminate"]], "poli.core.abstract_black_box.NegativeBlackBox": [[5, 2, 1, "", "__init__"]], "poli.core.abstract_problem_factory": [[8, 1, 1, "", "AbstractProblemFactory"], [9, 1, 1, "", "MetaProblemFactory"]], "poli.core.abstract_problem_factory.AbstractProblemFactory": [[8, 2, 1, "", "__init__"]], "poli.core.abstract_problem_factory.MetaProblemFactory": [[9, 2, 1, "", "__init__"]], "poli.core.chemistry": [[13, 0, 0, "-", "tdc_black_box"], [15, 0, 0, "-", "tdc_isolated_function"]], "poli.core.chemistry.tdc_black_box": [[14, 1, 1, "", "TDCBlackBox"]], "poli.core.chemistry.tdc_black_box.TDCBlackBox": [[14, 2, 1, "", "__init__"], [14, 3, 1, "", "oracle_name"]], "poli.core.exceptions": [[17, 4, 1, "", "BudgetExhaustedException"], [18, 4, 1, "", "PoliException"]], "poli.core.multi_objective_black_box": [[20, 1, 1, "", "MultiObjectiveBlackBox"]], "poli.core.multi_objective_black_box.MultiObjectiveBlackBox": [[20, 2, 1, "", "__init__"], [20, 2, 1, "", "_black_box"], [20, 3, 1, "", "objective_functions"]], "poli.core.proteins": [[25, 0, 0, "-", "foldx_black_box"], [27, 0, 0, "-", "foldx_isolated_function"]], "poli.core.proteins.foldx_black_box": [[26, 1, 1, "", "FoldxBlackBox"]], "poli.core.proteins.foldx_black_box.FoldxBlackBox": [[26, 2, 1, "", "__init__"], [26, 2, 1, "", "create_working_directory"], [26, 3, 1, "", "experiment_id"], [26, 3, 1, "", "tmp_folder"], [26, 3, 1, "", "wildtype_amino_acids"], [26, 3, 1, "", "wildtype_pdb_paths"], [26, 3, 1, "", "wildtype_residue_strings"], [26, 3, 1, "", "wildtype_residues"]], "poli.core.util": [[38, 0, 0, "-", "abstract_observer"], [40, 0, 0, "-", "algorithm_observer_wrapper"], [41, 0, 0, "-", "alignment"], [43, 0, 0, "-", "batch"], [46, 0, 0, "-", "chemistry"], [53, 0, 0, "-", "default_observer"], [54, 0, 0, "-", "external_observer"], [56, 0, 0, "-", "files"], [62, 0, 0, "-", "inter_process_communication"], [66, 0, 0, "-", "isolation"], [72, 0, 0, "-", "objective_management"], [76, 0, 0, "-", "observer_wrapper"], [78, 0, 0, "-", "proteins"], [99, 0, 0, "-", "seeding"]], "poli.core.util.abstract_observer": [[39, 1, 1, "", "AbstractObserver"]], "poli.core.util.abstract_observer.AbstractObserver": [[39, 2, 1, "", "__init__"], [39, 2, 1, "", "finish"], [39, 2, 1, "", "initialize_observer"], [39, 2, 1, "", "observe"]], "poli.core.util.alignment": [[42, 0, 0, "-", "is_aligned"]], "poli.core.util.batch": [[44, 0, 0, "-", "batch_input"]], "poli.core.util.batch.batch_input": [[45, 5, 1, "", "batched"]], "poli.core.util.chemistry": [[47, 0, 0, "-", "string_to_molecule"]], "poli.core.util.chemistry.string_to_molecule": [[48, 5, 1, "", "selfies_to_molecules"], [49, 5, 1, "", "smiles_to_molecules"], [50, 5, 1, "", "strings_to_molecules"], [51, 5, 1, "", "translate_selfies_to_smiles"], [52, 5, 1, "", "translate_smiles_to_selfies"]], "poli.core.util.external_observer": [[55, 1, 1, "", "ExternalObserver"]], "poli.core.util.external_observer.ExternalObserver": [[55, 2, 1, "", "__getattr__"], [55, 2, 1, "", "__init__"], [55, 2, 1, "", "finish"], [55, 2, 1, "", "initialize_observer"], [55, 2, 1, "", "observe"]], "poli.core.util.files": [[57, 0, 0, "-", "download_files_from_github"], [60, 0, 0, "-", "integrity"]], "poli.core.util.files.download_files_from_github": [[58, 5, 1, "", "download_file_from_github_repository"], [59, 5, 1, "", "get_sha_for_tag"]], "poli.core.util.files.integrity": [[61, 5, 1, "", "compute_md5_from_filepath"]], "poli.core.util.inter_process_communication": [[63, 0, 0, "-", "process_wrapper"]], "poli.core.util.inter_process_communication.process_wrapper": [[64, 1, 1, "", "ProcessWrapper"], [65, 5, 1, "", "get_connection"]], "poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper": [[64, 2, 1, "", "__init__"]], "poli.core.util.isolation": [[68, 0, 0, "-", "external_function"], [69, 0, 0, "-", "instancing"], [70, 0, 0, "-", "isolated_black_box"]], "poli.core.util.objective_management": [[73, 0, 0, "-", "make_run_script"]], "poli.core.util.objective_management.make_run_script": [[74, 5, 1, "", "make_observer_script"]], "poli.core.util.observer_wrapper": [[77, 5, 1, "", "start_observer_process"]], "poli.core.util.proteins": [[79, 0, 0, "-", "defaults"], [80, 0, 0, "-", "foldx"], [82, 0, 0, "-", "mutations"], [86, 0, 0, "-", "pdb_parsing"], [90, 0, 0, "-", "rasp"]], "poli.core.util.proteins.foldx": [[81, 1, 1, "", "FoldxInterface"]], "poli.core.util.proteins.foldx.FoldxInterface": [[81, 2, 1, "", "__init__"], [81, 2, 1, "", "_compute_sasa"], [81, 2, 1, "", "_read_energy"], [81, 2, 1, "", "_repair_if_necessary_and_provide_path"], [81, 2, 1, "", "_simulate_mutations"], [81, 2, 1, "", "compute_sasa"], [81, 2, 1, "", "compute_stability"], [81, 2, 1, "", "compute_stability_and_sasa"], [81, 2, 1, "", "copy_foldx_files"], [81, 2, 1, "", "repair"], [81, 3, 1, "", "verbose"], [81, 3, 1, "", "working_dir"], [81, 2, 1, "", "write_mutations_to_file"]], "poli.core.util.proteins.mutations": [[83, 5, 1, "", "edits_between_strings"], [84, 5, 1, "", "find_closest_wildtype_pdb_file_to_mutant"], [85, 5, 1, "", "mutations_from_wildtype_residues_and_mutant"]], "poli.core.util.proteins.pdb_parsing": [[87, 5, 1, "", "parse_pdb_as_residue_strings"], [88, 5, 1, "", "parse_pdb_as_residues"], [89, 5, 1, "", "parse_pdb_as_structure"]], "poli.core.util.proteins.rasp": [[91, 0, 0, "-", "inner_rasp"], [97, 6, 1, "", "load_models"], [98, 6, 1, "", "rasp_interface"]], "poli.core.util.proteins.rasp.inner_rasp": [[92, 6, 1, "", "PrismData"], [93, 6, 1, "", "cavity_model"]], "poli.core.util.seeding": [[100, 0, 0, "-", "seeding"]], "poli.core.util.seeding.seeding": [[101, 5, 1, "", "seed_numpy"], [102, 5, 1, "", "seed_python"]], "poli.objective_factory": [[109, 5, 1, "", "create"], [110, 5, 1, "", "load_config"], [111, 5, 1, "", "start"]], "poli.objective_repository": [[113, 0, 0, "-", "albuterol_similarity"], [116, 0, 0, "-", "aloha"], [120, 0, 0, "-", "amlodipine_mpo"], [123, 0, 0, "-", "celecoxib_rediscovery"], [126, 0, 0, "-", "deco_hop"], [129, 0, 0, "-", "dockstring"], [135, 0, 0, "-", "drd2_docking"], [138, 0, 0, "-", "drd3_docking"], [144, 0, 0, "-", "ehrlich"], [147, 0, 0, "-", "fexofenadine_mpo"], [150, 0, 0, "-", "foldx_rfp_lambo"], [158, 0, 0, "-", "foldx_sasa"], [165, 0, 0, "-", "foldx_stability"], [172, 0, 0, "-", "foldx_stability_and_sasa"], [178, 0, 0, "-", "gfp_cbas"], [212, 0, 0, "-", "gfp_select"], [218, 0, 0, "-", "gsk3_beta"], [221, 0, 0, "-", "isomer_c7h8n2o2"], [224, 0, 0, "-", "isomer_c9h10n2o2pf2cl"], [227, 0, 0, "-", "jnk3"], [230, 0, 0, "-", "median_1"], [233, 0, 0, "-", "median_2"], [236, 0, 0, "-", "mestranol_similarity"], [239, 0, 0, "-", "osimetrinib_mpo"], [242, 0, 0, "-", "penalized_logp_lambo"], [248, 0, 0, "-", "perindopril_mpo"], [251, 0, 0, "-", "ranolazine_mpo"], [254, 0, 0, "-", "rasp"], [258, 0, 0, "-", "rdkit_logp"], [263, 0, 0, "-", "rdkit_qed"], [268, 0, 0, "-", "rfp_foldx_stability_and_sasa"], [271, 0, 0, "-", "rmf_landscape"], [275, 0, 0, "-", "sa_tdc"], [281, 0, 0, "-", "scaffold_hop"], [284, 0, 0, "-", "sitagliptin_mpo"], [287, 0, 0, "-", "super_mario_bros"], [302, 0, 0, "-", "thiothixene_rediscovery"], [305, 0, 0, "-", "toy_continuous_problem"], [329, 0, 0, "-", "troglitazone_rediscovery"], [332, 0, 0, "-", "valsartan_smarts"], [335, 0, 0, "-", "white_noise"], [339, 0, 0, "-", "zaleplon_mpo"]], "poli.objective_repository.albuterol_similarity": [[115, 0, 0, "-", "register"]], "poli.objective_repository.aloha": [[117, 0, 0, "-", "register"]], "poli.objective_repository.aloha.register": [[118, 1, 1, "", "AlohaBlackBox"], [119, 1, 1, "", "AlohaProblemFactory"]], "poli.objective_repository.aloha.register.AlohaBlackBox": [[118, 2, 1, "", "__init__"], [118, 2, 1, "", "_black_box"], [118, 3, 1, "", "alphabet"]], "poli.objective_repository.aloha.register.AlohaProblemFactory": [[119, 2, 1, "", "__init__"], [119, 2, 1, "", "create"]], "poli.objective_repository.amlodipine_mpo": [[122, 0, 0, "-", "register"]], "poli.objective_repository.celecoxib_rediscovery": [[125, 0, 0, "-", "register"]], "poli.objective_repository.deco_hop": [[128, 0, 0, "-", "register"]], "poli.objective_repository.dockstring": [[131, 0, 0, "-", "isolated_function"], [132, 0, 0, "-", "register"]], "poli.objective_repository.dockstring.register": [[133, 1, 1, "", "DockstringBlackBox"], [134, 1, 1, "", "DockstringProblemFactory"]], "poli.objective_repository.dockstring.register.DockstringBlackBox": [[133, 2, 1, "", "__init__"], [133, 2, 1, "", "_black_box"], [133, 3, 1, "", "alphabet"]], "poli.objective_repository.dockstring.register.DockstringProblemFactory": [[134, 2, 1, "", "__init__"], [134, 2, 1, "", "create"]], "poli.objective_repository.drd2_docking": [[137, 0, 0, "-", "register"]], "poli.objective_repository.drd3_docking": [[141, 0, 0, "-", "register"]], "poli.objective_repository.drd3_docking.register": [[142, 1, 1, "", "DRD3BlackBox"], [143, 1, 1, "", "DRD3ProblemFactory"]], "poli.objective_repository.drd3_docking.register.DRD3BlackBox": [[142, 2, 1, "id0", "__init__"], [142, 3, 1, "", "oracle_name"]], "poli.objective_repository.drd3_docking.register.DRD3ProblemFactory": [[143, 2, 1, "", "__init__"]], "poli.objective_repository.ehrlich": [[146, 0, 0, "-", "register"]], "poli.objective_repository.ehrlich.register": [[407, 1, 1, "", "EhrlichBlackBox"], [407, 1, 1, "", "EhrlichProblemFactory"]], "poli.objective_repository.ehrlich.register.EhrlichBlackBox": [[407, 2, 1, "", "construct_optimal_solution"], [407, 2, 1, "", "construct_random_motifs"], [407, 2, 1, "", "construct_random_offsets"]], "poli.objective_repository.ehrlich.register.EhrlichProblemFactory": [[407, 2, 1, "", "create"]], "poli.objective_repository.fexofenadine_mpo": [[149, 0, 0, "-", "register"]], "poli.objective_repository.foldx_rfp_lambo": [[151, 0, 0, "-", "information"], [152, 0, 0, "-", "isolated_function"], [153, 0, 0, "-", "register"]], "poli.objective_repository.foldx_sasa": [[161, 0, 0, "-", "isolated_function"], [162, 0, 0, "-", "register"]], "poli.objective_repository.foldx_sasa.register": [[163, 1, 1, "", "FoldXSASABlackBox"], [164, 1, 1, "", "FoldXSASAProblemFactory"]], "poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox": [[163, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory": [[164, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_stability": [[168, 0, 0, "-", "isolated_function"], [169, 0, 0, "-", "register"]], "poli.objective_repository.foldx_stability.register": [[170, 1, 1, "", "FoldXStabilityBlackBox"], [171, 1, 1, "", "FoldXStabilityProblemFactory"]], "poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox": [[170, 2, 1, "", "__init__"], [170, 2, 1, "", "_black_box"]], "poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory": [[171, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_stability_and_sasa": [[174, 0, 0, "-", "isolated_function"], [175, 0, 0, "-", "register"]], "poli.objective_repository.foldx_stability_and_sasa.register": [[176, 1, 1, "", "FoldXStabilityAndSASABlackBox"], [177, 1, 1, "", "FoldXStabilityAndSASAProblemFactory"]], "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox": [[176, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory": [[177, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas": [[179, 0, 0, "-", "abstract_vae_wrapper"], [181, 0, 0, "-", "cbas_alphabet_preprocessing"], [196, 0, 0, "-", "cbas_wrapper"], [200, 0, 0, "-", "gfp_gp"], [201, 0, 0, "-", "information"], [202, 0, 0, "-", "isolated_function"], [203, 0, 0, "-", "make_vae"], [209, 0, 0, "-", "register"]], "poli.objective_repository.gfp_cbas.abstract_vae_wrapper": [[180, 1, 1, "", "AbstractVAEWrapper"]], "poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper": [[180, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing": [[182, 5, 1, "", "convert_aas_to_idx_array"], [183, 5, 1, "", "convert_idx_array_to_aas"], [184, 5, 1, "", "convert_mutations_to_sequence"], [185, 5, 1, "", "get_argmax"], [186, 5, 1, "", "get_balaji_predictions"], [187, 5, 1, "", "get_experimental_X_y"], [188, 5, 1, "", "get_gfp_X_y_aa"], [189, 5, 1, "", "get_gfp_base_seq"], [190, 5, 1, "", "get_samples"], [191, 5, 1, "", "one_hot_encode_aa"], [192, 5, 1, "", "one_hot_encode_aa_array"], [193, 5, 1, "", "one_hot_encode_dna"], [194, 5, 1, "", "partition_data"], [195, 5, 1, "", "read_gfp_data"]], "poli.objective_repository.gfp_cbas.cbas_wrapper": [[197, 1, 1, "", "CBASVAEWrapper"], [198, 1, 1, "", "ConvertedTorchVaeDecoder"], [199, 1, 1, "", "ConvertedTorchVaeEncoder"]], "poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper": [[197, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder": [[198, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder": [[199, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.make_vae": [[204, 1, 1, "", "BaseVAE"], [205, 1, 1, "", "SimpleVAE"], [206, 5, 1, "", "build_vae"], [207, 5, 1, "", "identity_loss"], [208, 5, 1, "", "summed_categorical_crossentropy"]], "poli.objective_repository.gfp_cbas.make_vae.BaseVAE": [[204, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.make_vae.SimpleVAE": [[205, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.register": [[210, 1, 1, "", "GFPCBasBlackBox"], [211, 1, 1, "", "GFPCBasProblemFactory"]], "poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox": [[210, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory": [[211, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_select": [[213, 0, 0, "-", "information"], [214, 0, 0, "-", "isolated_function"], [215, 0, 0, "-", "register"]], "poli.objective_repository.gfp_select.register": [[217, 1, 1, "", "GFPSelectionProblemFactory"]], "poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory": [[217, 2, 1, "", "__init__"]], "poli.objective_repository.gsk3_beta": [[220, 0, 0, "-", "register"]], "poli.objective_repository.isomer_c7h8n2o2": [[223, 0, 0, "-", "register"]], "poli.objective_repository.isomer_c9h10n2o2pf2cl": [[226, 0, 0, "-", "register"]], "poli.objective_repository.jnk3": [[229, 0, 0, "-", "register"]], "poli.objective_repository.median_1": [[232, 0, 0, "-", "register"]], "poli.objective_repository.median_2": [[235, 0, 0, "-", "register"]], "poli.objective_repository.mestranol_similarity": [[238, 0, 0, "-", "register"]], "poli.objective_repository.osimetrinib_mpo": [[241, 0, 0, "-", "register"]], "poli.objective_repository.penalized_logp_lambo": [[244, 0, 0, "-", "isolated_function"], [245, 0, 0, "-", "register"]], "poli.objective_repository.penalized_logp_lambo.register": [[246, 1, 1, "", "PenalizedLogPLamboBlackBox"], [247, 1, 1, "", "PenalizedLogPLamboProblemFactory"]], "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox": [[246, 2, 1, "", "__init__"]], "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory": [[247, 2, 1, "", "__init__"]], "poli.objective_repository.perindopril_mpo": [[250, 0, 0, "-", "register"]], "poli.objective_repository.ranolazine_mpo": [[253, 0, 0, "-", "register"]], "poli.objective_repository.rasp": [[256, 0, 0, "-", "isolated_function"], [257, 0, 0, "-", "register"]], "poli.objective_repository.rdkit_logp": [[260, 0, 0, "-", "register"]], "poli.objective_repository.rdkit_logp.register": [[261, 1, 1, "", "LogPBlackBox"], [262, 1, 1, "", "LogPProblemFactory"]], "poli.objective_repository.rdkit_logp.register.LogPBlackBox": [[261, 2, 1, "", "__init__"], [261, 2, 1, "", "_black_box"], [261, 3, 1, "", "from_selfies"], [261, 3, 1, "", "from_smiles"]], "poli.objective_repository.rdkit_logp.register.LogPProblemFactory": [[262, 2, 1, "", "__init__"]], "poli.objective_repository.rdkit_qed": [[265, 0, 0, "-", "register"]], "poli.objective_repository.rdkit_qed.register": [[266, 1, 1, "", "QEDBlackBox"], [267, 1, 1, "", "QEDProblemFactory"]], "poli.objective_repository.rdkit_qed.register.QEDBlackBox": [[266, 2, 1, "", "__init__"], [266, 2, 1, "", "_black_box"], [266, 3, 1, "", "from_selfies"], [266, 3, 1, "", "from_smiles"]], "poli.objective_repository.rdkit_qed.register.QEDProblemFactory": [[267, 2, 1, "", "__init__"], [267, 2, 1, "", "create"]], "poli.objective_repository.rfp_foldx_stability_and_sasa": [[270, 0, 0, "-", "register"]], "poli.objective_repository.rmf_landscape": [[273, 0, 0, "-", "isolated_function"], [274, 0, 0, "-", "register"]], "poli.objective_repository.sa_tdc": [[276, 0, 0, "-", "information"], [277, 0, 0, "-", "isolated_function"], [278, 0, 0, "-", "register"]], "poli.objective_repository.sa_tdc.register": [[279, 1, 1, "", "SABlackBox"], [280, 1, 1, "", "SAProblemFactory"]], "poli.objective_repository.sa_tdc.register.SABlackBox": [[279, 2, 1, "", "__init__"]], "poli.objective_repository.sa_tdc.register.SAProblemFactory": [[280, 2, 1, "", "__init__"], [280, 2, 1, "", "create"]], "poli.objective_repository.scaffold_hop": [[282, 0, 0, "-", "information"], [283, 0, 0, "-", "register"]], "poli.objective_repository.sitagliptin_mpo": [[285, 0, 0, "-", "information"], [286, 0, 0, "-", "register"]], "poli.objective_repository.super_mario_bros": [[288, 0, 0, "-", "information"], [289, 0, 0, "-", "level_utils"], [301, 0, 0, "-", "register"]], "poli.objective_repository.super_mario_bros.level_utils": [[290, 5, 1, "", "add_padding_to_level"], [291, 5, 1, "", "clean_level"], [292, 5, 1, "", "level_to_array"], [293, 5, 1, "", "level_to_list"], [294, 5, 1, "", "levels_to_onehot"], [295, 5, 1, "", "onehot_to_levels"], [297, 5, 1, "", "vectorized"]], "poli.objective_repository.thiothixene_rediscovery": [[304, 0, 0, "-", "register"]], "poli.objective_repository.toy_continuous_problem": [[306, 0, 0, "-", "definitions"], [324, 0, 0, "-", "register"], [327, 0, 0, "-", "toy_continuous_problem"]], "poli.objective_repository.toy_continuous_problem.definitions": [[307, 5, 1, "", "ackley_function_01"], [308, 5, 1, "", "alpine_01"], [309, 5, 1, "", "alpine_02"], [310, 5, 1, "", "bent_cigar"], [311, 5, 1, "", "brown"], [312, 5, 1, "", "camelback_2d"], [313, 5, 1, "", "chung_reynolds"], [314, 5, 1, "", "cosine_mixture"], [315, 5, 1, "", "cross_in_tray"], [316, 5, 1, "", "deb_01"], [317, 5, 1, "", "deb_02"], [318, 5, 1, "", "deflected_corrugated_spring"], [319, 5, 1, "", "easom"], [320, 5, 1, "", "egg_holder"], [321, 5, 1, "", "shifted_sphere"], [322, 5, 1, "", "styblinski_tang"]], "poli.objective_repository.toy_continuous_problem.register": [[325, 1, 1, "", "ToyContinuousBlackBox"], [326, 1, 1, "", "ToyContinuousProblemFactory"]], "poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox": [[325, 2, 1, "", "__init__"], [325, 2, 1, "", "_black_box"], [325, 3, 1, "", "bounds"], [325, 3, 1, "", "embed_in"], [325, 3, 1, "", "function"], [325, 3, 1, "", "function_name"], [325, 3, 1, "", "n_dimensions"]], "poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory": [[326, 2, 1, "", "__init__"]], "poli.objective_repository.toy_continuous_problem.toy_continuous_problem": [[328, 1, 1, "", "ToyContinuousProblem"]], "poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem": [[328, 2, 1, "", "__init__"]], "poli.objective_repository.troglitazone_rediscovery": [[331, 0, 0, "-", "register"]], "poli.objective_repository.valsartan_smarts": [[334, 0, 0, "-", "register"]], "poli.objective_repository.white_noise": [[336, 0, 0, "-", "register"]], "poli.objective_repository.white_noise.register": [[337, 1, 1, "", "WhiteNoiseBlackBox"], [338, 1, 1, "", "WhiteNoiseProblemFactory"]], "poli.objective_repository.white_noise.register.WhiteNoiseBlackBox": [[337, 2, 1, "", "__init__"], [337, 2, 1, "", "_black_box"]], "poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory": [[338, 2, 1, "", "__init__"]], "poli.objective_repository.zaleplon_mpo": [[341, 0, 0, "-", "register"]], "poli.tests": [[344, 0, 0, "-", "benchmarks"], [346, 0, 0, "-", "conftest"], [347, 0, 0, "-", "docs_examples"], [355, 0, 0, "-", "information"], [357, 0, 0, "-", "registry"], [380, 0, 0, "-", "test_core_promises"], [383, 0, 0, "-", "test_seeding"], [385, 0, 0, "-", "util"]], "poli.tests.information": [[356, 0, 0, "-", "test_dynamic_information"]], "poli.tests.registry": [[358, 0, 0, "-", "basic_objectives"], [363, 0, 0, "-", "chemistry"], [365, 0, 0, "-", "proteins"], [369, 0, 0, "-", "test_basic_loop_without_create"], [371, 0, 0, "-", "test_force_isolation"], [373, 0, 0, "-", "test_multi_objective_and_negative"], [375, 0, 0, "-", "toy_continuous_problems"], [379, 0, 0, "-", "toy_discrete_problems"]], "poli.tests.registry.basic_objectives": [[359, 0, 0, "-", "test_basic_objectives"]], "poli.tests.registry.basic_objectives.test_basic_objectives": [[360, 5, 1, "", "test_registering_aloha"], [361, 5, 1, "", "test_registering_white_noise"]], "poli.tests.registry.toy_continuous_problems": [[376, 0, 0, "-", "test_embedding_problems_into_higher_dims"]], "poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims": [[377, 5, 1, "", "test_embed_camelback_into_high_dimensions"]]}, "objtypes": {"0": "py:module", "1": "py:class", "2": "py:method", "3": "py:attribute", "4": "py:exception", "5": "py:function", "6": "py:data"}, "objnames": {"0": ["py", "module", "Python module"], "1": ["py", "class", "Python class"], "2": ["py", "method", "Python method"], "3": ["py", "attribute", "Python attribute"], "4": ["py", "exception", "Python exception"], "5": ["py", "function", "Python function"], "6": ["py", "data", "Python data"]}, "titleterms": {"poli": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 389, 392, 393, 394, 439, 440], "core": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 438], "abstract_black_box": [3, 4, 5], "abstractblackbox": 4, "negativeblackbox": 5, "abstract_problem_factori": [7, 8, 9], "abstractproblemfactori": 8, "metaproblemfactori": 9, "chemistri": [12, 13, 14, 15, 46, 47, 48, 49, 50, 51, 52, 363, 364], "tdc_black_box": [13, 14], "tdcblackbox": 14, "except": [16, 17, 18], "budgetexhaustedexcept": 17, "poliexcept": 18, "multi_objective_black_box": [19, 20], "multiobjectiveblackbox": 20, "problem_setup_inform": [22, 23], "problemsetupinform": 23, "protein": [24, 25, 26, 27, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 365, 366, 367, 368, 394, 396, 399, 409, 410, 411, 436], "foldx_black_box": [25, 26], "foldxblackbox": 26, "registri": [28, 29, 30, 31, 32, 33, 34, 35, 36, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379], "delete_observer_run_script": 29, "delete_problem": 30, "get_problem_factori": 31, "get_problem": 32, "register_problem": 33, "register_problem_from_repositori": 34, "set_observ": 35, "set_observer_run_script": 36, "util": [37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 385, 386, 387], "abstract_observ": [38, 39], "abstractobserv": 39, "align": [41, 42, 454], "is_align": 42, "batch": [43, 44, 45, 437], "batch_input": [44, 45], "string_to_molecul": [47, 48, 49, 50, 51, 52], "selfies_to_molecul": 48, "smiles_to_molecul": 49, "strings_to_molecul": 50, "translate_selfies_to_smil": 51, "translate_smiles_to_selfi": 52, "external_observ": [54, 55], "externalobserv": 55, "file": [56, 57, 58, 59, 60, 61, 396, 406, 410, 411], "download_files_from_github": [57, 58, 59], "download_file_from_github_repositori": 58, "get_sha_for_tag": 59, "integr": [60, 61], "compute_md5_from_filepath": 61, "inter_process_commun": [62, 63, 64, 65], "process_wrapp": [63, 64, 65], "processwrapp": 64, "get_connect": 65, "objective_manag": [72, 73, 74, 75], "make_run_script": [73, 74, 75], "make_observer_script": 74, "observer_wrapp": [76, 77], "start_observer_process": 77, "default": 79, "foldx": [80, 81, 395, 409, 410, 411], "foldxinterfac": 81, "mutat": [82, 83, 84, 85, 396, 436, 453], "edits_between_str": 83, "find_closest_wildtype_pdb_file_to_mut": 84, "mutations_from_wildtype_residues_and_mut": 85, "pdb_pars": [86, 87, 88, 89], "parse_pdb_as_residue_str": 87, "parse_pdb_as_residu": 88, "parse_pdb_as_structur": 89, "rasp": [90, 91, 92, 93, 94, 95, 96, 97, 98, 254, 255, 256, 257], "inner_rasp": [91, 92, 93, 94, 95, 96], "prismdata": 92, "cavity_model": 93, "helper": 94, "run_pipelin": 95, "visual": 96, "load_model": 97, "rasp_interfac": 98, "seed": [99, 100, 101, 102], "seed_numpi": 101, "seed_python": 102, "object": [103, 104, 105, 106, 394, 399, 400, 428, 430, 433, 436, 440, 441], "dynamically_instanti": 104, "parse_factory_kwarg": 105, "run": [106, 394, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 441, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "objective_factori": [107, 108, 109, 110, 111], "externalblackbox": 108, "creat": [109, 138, 430, 440], "load_config": 110, "start": [111, 393, 394], "objective_repositori": [112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341], "aloha": [116, 117, 118, 119, 400, 438], "regist": [115, 117, 118, 119, 122, 125, 128, 132, 133, 134, 137, 141, 142, 143, 146, 149, 153, 154, 155, 156, 157, 162, 163, 164, 169, 170, 171, 175, 176, 177, 209, 210, 211, 215, 216, 217, 220, 223, 226, 229, 232, 235, 238, 241, 245, 246, 247, 250, 253, 257, 260, 261, 262, 265, 266, 267, 270, 274, 278, 279, 280, 283, 286, 301, 304, 324, 325, 326, 331, 334, 336, 337, 338, 341, 391, 435, 436], "alohablackbox": 118, "alohaproblemfactori": 119, "dockstr": [129, 130, 131, 132, 133, 134, 404], "dockstringblackbox": 133, "dockstringproblemfactori": 134, "drd3_dock": [138, 139, 140, 141, 142, 143], "prerequisit": [138, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434], "instal": [138, 391, 393, 395, 406, 409], "autodock": [138, 406], "vina": [138, 406], "adfr": [138, 406], "suit": [138, 406], "poli__lambo": 138, "environ": [138, 391, 409], "drd3blackbox": 142, "drd3problemfactori": 143, "foldx_rfp_lambo": [150, 151, 152, 153, 154, 155, 156, 157], "config": 154, "rfpwrapper": 155, "rfpwrapperfactori": 156, "get_config": 157, "foldx_sasa": [158, 159, 160, 161, 162, 163, 164], "foldx_util": [159, 166], "foldxsasablackbox": 163, "foldxsasaproblemfactori": 164, "foldx_stabl": [165, 166, 167, 168, 169, 170, 171], "foldxstabilityblackbox": 170, "foldxstabilityproblemfactori": 171, "foldx_stability_and_sasa": [172, 173, 174, 175, 176, 177], "foldxstabilityandsasablackbox": 176, "foldxstabilityandsasaproblemfactori": 177, "gfp_cba": [178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211], "abstract_vae_wrapp": [179, 180], "abstractvaewrapp": 180, "cbas_alphabet_preprocess": [181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195], "convert_aas_to_idx_arrai": 182, "convert_idx_array_to_aa": 183, "convert_mutations_to_sequ": 184, "get_argmax": 185, "get_balaji_predict": 186, "get_experimental_x_i": 187, "get_gfp_x_y_aa": 188, "get_gfp_base_seq": 189, "get_sampl": 190, "one_hot_encode_aa": 191, "one_hot_encode_aa_arrai": 192, "one_hot_encode_dna": 193, "partition_data": 194, "read_gfp_data": 195, "cbas_wrapp": [196, 197, 198, 199], "cbasvaewrapp": 197, "convertedtorchvaedecod": 198, "convertedtorchvaeencod": 199, "gfp_gp": 200, "make_va": [203, 204, 205, 206, 207, 208], "baseva": 204, "simpleva": 205, "build_va": 206, "identity_loss": 207, "summed_categorical_crossentropi": 208, "gfpcbasblackbox": 210, "gfpcbasproblemfactori": 211, "gfp_select": [212, 213, 214, 215, 216, 217], "gfpblackbox": 216, "gfpselectionproblemfactori": 217, "penalized_logp_lambo": [242, 243, 244, 245, 246, 247], "penalizedlogplamboblackbox": 246, "penalizedlogplamboproblemfactori": 247, "rdkit_logp": [258, 259, 260, 261, 262], "logpblackbox": 261, "logpproblemfactori": 262, "rdkit_q": [263, 264, 265, 266, 267], "qedblackbox": 266, "qedproblemfactori": 267, "rfp_foldx_stability_and_sasa": [268, 269, 270], "sa_tdc": [275, 276, 277, 278, 279, 280], "sablackbox": 279, "saproblemfactori": 280, "super_mario_bro": [287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301], "level_util": [289, 290, 291, 292, 293, 294, 295, 296, 297], "add_padding_to_level": 290, "clean_level": 291, "level_to_arrai": 292, "level_to_list": 293, "levels_to_onehot": 294, "onehot_to_level": 295, "tensor_to_sim_level": 296, "vector": 297, "model": [298, 299, 300], "vaemario": 299, "load_example_model": 300, "toy_continuous_problem": [305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 375, 376, 377, 378], "definit": [306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322], "ackley_function_01": 307, "alpine_01": 308, "alpine_02": 309, "bent_cigar": 310, "brown": 311, "camelback_2d": 312, "chung_reynold": 313, "cosine_mixtur": 314, "cross_in_trai": 315, "deb_01": 316, "deb_02": 317, "deflected_corrugated_spr": 318, "easom": 319, "egg_hold": 320, "shifted_spher": 321, "styblinski_tang": 322, "toycontinuousblackbox": 325, "toycontinuousproblemfactori": 326, "toycontinuousproblem": 328, "white_nois": [335, 336, 337, 338], "whitenoiseblackbox": 337, "whitenoiseproblemfactori": 338, "registered_object": 342, "test": [343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 391, 393], "docs_exampl": [347, 348, 349, 350, 351, 352, 353, 354], "test_objective_funct": [348, 349, 350, 351, 352, 353, 354], "test_aloha_exampl": 349, "test_logp_exampl": 350, "test_logp_example_using_str": 351, "test_qed_exampl": 352, "test_qed_example_using_str": 353, "test_white_noise_exampl": 354, "basic_object": [358, 359, 360, 361, 362], "test_basic_object": [359, 360, 361], "test_registering_aloha": 360, "test_registering_white_nois": 361, "test_budget_exhaust": 362, "test_chemistry_object": 364, "test_foldx": 366, "test_foldx_rfp_lambo": 367, "test_rasp": 368, "test_basic_loop_without_cr": 369, "test_force_isol": 371, "test_passing_array_of_str": 374, "test_embedding_problems_into_higher_dim": [376, 377], "test_embed_camelback_into_high_dimens": 377, "test_instancing_of_toy_continuous_problem": 378, "test_minimal_working_exampl": [381, 382], "test_seed": [383, 384], "test_seeding_in_white_nois": 384, "test_foldx_interfac": 386, "test_protein_util": 387, "api": [389, 407], "document": 389, "refer": [390, 407, 442, 443, 445, 448, 450, 452, 454, 455, 456], "ad": [391, 392], "new": [391, 392], "problem": [21, 391, 392, 394, 399, 430, 436, 437], "repositori": 391, "The": [391, 438, 440], "structur": 391, "A": 391, "gener": 391, "py": 391, "yml": 391, "why": 391, "conda": [391, 393], "your": [391, 393, 440], "option": 441, "make": 406, "avail": [], "depend": [], "ar": [394, 396], "met": [], "submit": [391, 392], "pull": [391, 392], "request": [391, 392], "optim": [392, 394, 427, 436, 440, 442, 444, 448, 449, 450, 454, 455, 456], "baselin": [392, 393], "an": [392, 437, 438], "abstract": [392, 437, 438], "solver": [392, 394, 436, 437, 440], "exampl": [392, 437, 438], "randommut": [392, 436, 437], "get": [393, 394], "first": 393, "script": 393, "us": [393, 394, 398, 401, 402, 403, 405, 406, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 429, 431, 432, 434, 436, 440], "librari": 394, "discret": [394, 451], "function": [394, 399, 400, 407, 428, 430, 433, 436, 440, 441], "black": [391, 394, 433, 441], "box": [391, 394, 433, 441], "toi": [394, 399, 430], "small": [394, 399], "molecul": [394, 399], "algorithm": [394, 447, 455], "cite": [394, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434], "other": [394, 396, 399], "relev": 394, "work": [394, 439], "contribut": 394, "comput": 396, "energi": 396, "singl": 396, "python": [396, 409], "set": [396, 406], "up": 396, "folder": [396, 406], "download": [396, 406], "pdb": 396, "repair": [396, 410, 411], "what": [396, 437, 440, 441], "pars": 396, "wildtyp": 396, "defin": [396, 436, 437, 438], "s": [391, 396, 448], "sasa": [396, 409], "score": 396, "conclus": [396, 438, 440], "rapid": 397, "stabil": [397, 409, 411, 436], "predict": 397, "how": [397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 439, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "warn": 397, "further": 397, "read": [397, 441], "all": [399, 406, 438], "about": [398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 437, 442, 443, 444, 445, 446, 448, 450, 451, 452, 453, 454, 455, 456], "drd3": 406, "dock": [405, 406], "tdc": [398, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "add": 406, "binari": 406, "path": 406, "prepare_receptor": 406, "from": [], "sure": 406, "you": [406, 410, 411], "re": 406, "rfp": 409, "lambo": [409, 420], "we": [394, 409, 410, 411], "can": [409, 410, 411], "automat": 409, "solvent": 410, "access": [410, 424], "penal": 420, "logp": [420, 422], "keyword": [], "argument": [], "log": [422, 438], "solubl": 422, "quantit": 423, "estim": 423, "druglik": 423, "qed": 423, "synthet": 424, "jump": 427, "super": 427, "mario": 427, "bro": 427, "therapeut": [], "data": [], "common": [], "oracl": [], "name": 428, "see": [428, 442, 443, 444, 448, 451, 454, 456], "also": 428, "continu": [394, 430], "low": 430, "intrins": 430, "dimension": 430, "white": 433, "nois": 433, "observ": [435, 438], "isol": [66, 67, 68, 69, 70, 435, 441], "process": 435, "random": [436, 453], "mroug": 436, "check": 436, "result": 436, "poli_baselin": 437, "candid": 437, "want": 438, "more": [438, 441, 442, 443, 444, 448, 451, 454, 456], "complex": 438, "instanc": [69, 438], "simpl": 438, "initi": 438, "put": 438, "togeth": 438, "coupl": 438, "queri": 438, "dive": 439, "deeper": 439, "doe": 439, "under": [439, 441], "hood": [439, 441], "content": [439, 440], "usual": 440, "develop": 440, "loop": 440, "identifi": 440, "own": 440, "when": [], "have": [], "right": [], "Is": [], "factori": [], "entir": [], "need": [], "where": [], "thi": 427, "call": [], "bayesian": [442, 444, 448, 449, 450, 454, 456], "cma": 446, "es": 446, "graph": 447, "genet": 447, "latent": 449, "space": 449, "line": 450, "nsga": 451, "2": [417, 451], "templat": 455, "abstract_isolated_funct": 6, "black_box_inform": 11, "tdc_isolated_funct": 15, "foldx_isolated_funct": 27, "external_black_box": 67, "external_funct": 68, "isolated_black_box": 70, "inform": [114, 121, 124, 127, 130, 136, 139, 145, 148, 151, 160, 167, 173, 201, 213, 219, 222, 225, 228, 231, 234, 237, 240, 243, 249, 252, 255, 259, 264, 269, 272, 276, 282, 285, 288, 303, 323, 330, 333, 340, 355, 356, 391, 433], "isolated_funct": [131, 140, 152, 161, 168, 174, 202, 214, 244, 256, 273, 277, 391], "test_instancing_black_boxes_alon": 372, "specifi": 391, "__init__": 391, "happen": 441, "test_black_box_instanc": 370, "test_multi_objective_and_neg": 373, "test_core_promis": 380, "cluster": 427, "albuterol_similar": [113, 114, 115], "amlodipine_mpo": [120, 121, 122], "celecoxib_rediscoveri": [123, 124, 125], "deco_hop": [126, 127, 128], "drd2_dock": [135, 136, 137], "fexofenadine_mpo": [147, 148, 149], "gsk3_beta": [218, 219, 220], "isomer_c7h8n2o2": [221, 222, 223], "isomer_c9h10n2o2pf2cl": [224, 225, 226], "jnk3": [227, 228, 229], "median_1": [230, 231, 232], "median_2": [233, 234, 235], "mestranol_similar": [236, 237, 238], "osimetrinib_mpo": [239, 240, 241], "perindopril_mpo": [248, 249, 250], "ranolazine_mpo": [251, 252, 253], "scaffold_hop": [281, 282, 283], "sitagliptin_mpo": [284, 285, 286], "thiothixene_rediscoveri": [302, 303, 304], "troglitazone_rediscoveri": [329, 330, 331], "valsartan_smart": [332, 333, 334], "zaleplon_mpo": [339, 340, 341], "albuterol": 398, "similar": [398, 418], "drd2": 405, "gsk3\u03b2": 412, "mestranol": 418, "celecoxib": 402, "rediscoveri": [402, 429, 431], "thiothixen": 429, "troglitazon": 431, "amlodipin": 401, "mpo": [401, 408, 419, 421, 426, 434], "fexofenadin": 408, "osimetrinib": 419, "ranolazin": 421, "sitagliptin": 426, "zaleplon": 434, "deco": 403, "hop": [403, 425], "scaffold": 425, "isom": [413, 414], "c7h8n2o2": 413, "c9h10n2o2pf2cl": 414, "median": [416, 417], "1": 416, "valsartan": 432, "smart": 432, "c": 415, "jun": 415, "n": 415, "termin": 415, "kinas": 415, "3": 415, "abstract_benchmark": 2, "benchmark_inform": 10, "benchmark": [344, 345, 394], "test_benchmark_cr": 345, "hvarfner": 448, "vanilla": 448, "spars": 454, "axi": 454, "subspac": [443, 454], "saasbo": 454, "multi_observ": 71, "alebo": 442, "adapt": [442, 443], "linear": 442, "embed": 442, "trust": 456, "region": 456, "turbo": 456, "expand": 443, "baxu": 443, "bounc": 445, "probabilist": 452, "reparametr": 452, "algorithm_observer_wrapp": 40, "default_observ": 53, "ehrlich": [144, 145, 146, 407], "rmf_landscap": [271, 272, 273, 274], "conftest": 346, "toy_discrete_problem": 379, "test_dynamic_inform": 356}, "envversion": {"sphinx.domains.c": 2, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 6, "sphinx.domains.index": 1, "sphinx.domains.javascript": 2, "sphinx.domains.math": 2, "sphinx.domains.python": 3, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.intersphinx": 1, "sphinxcontrib.bibtex": 9, "sphinx": 56}}) \ No newline at end of file +Search.setIndex({"docnames": ["_autosummary/poli", "_autosummary/poli.core", "_autosummary/poli.core.abstract_benchmark", "_autosummary/poli.core.abstract_black_box", "_autosummary/poli.core.abstract_black_box.AbstractBlackBox", "_autosummary/poli.core.abstract_black_box.NegativeBlackBox", "_autosummary/poli.core.abstract_isolated_function", "_autosummary/poli.core.abstract_problem_factory", "_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory", "_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory", "_autosummary/poli.core.benchmark_information", "_autosummary/poli.core.black_box_information", "_autosummary/poli.core.chemistry", "_autosummary/poli.core.chemistry.tdc_black_box", "_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox", "_autosummary/poli.core.chemistry.tdc_isolated_function", "_autosummary/poli.core.exceptions", "_autosummary/poli.core.exceptions.BudgetExhaustedException", "_autosummary/poli.core.exceptions.PoliException", "_autosummary/poli.core.multi_objective_black_box", "_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox", "_autosummary/poli.core.problem", "_autosummary/poli.core.problem_setup_information", "_autosummary/poli.core.problem_setup_information.ProblemSetupInformation", "_autosummary/poli.core.proteins", "_autosummary/poli.core.proteins.foldx_black_box", "_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox", "_autosummary/poli.core.proteins.foldx_isolated_function", "_autosummary/poli.core.registry", "_autosummary/poli.core.registry.delete_observer_run_script", "_autosummary/poli.core.registry.delete_problem", "_autosummary/poli.core.registry.get_problem_factories", "_autosummary/poli.core.registry.get_problems", "_autosummary/poli.core.registry.register_problem", "_autosummary/poli.core.registry.register_problem_from_repository", "_autosummary/poli.core.registry.set_observer", "_autosummary/poli.core.registry.set_observer_run_script", "_autosummary/poli.core.util", "_autosummary/poli.core.util.abstract_observer", "_autosummary/poli.core.util.abstract_observer.AbstractObserver", "_autosummary/poli.core.util.algorithm_observer_wrapper", "_autosummary/poli.core.util.alignment", "_autosummary/poli.core.util.alignment.is_aligned", "_autosummary/poli.core.util.batch", "_autosummary/poli.core.util.batch.batch_input", "_autosummary/poli.core.util.batch.batch_input.batched", "_autosummary/poli.core.util.chemistry", "_autosummary/poli.core.util.chemistry.string_to_molecule", "_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules", "_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules", "_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies", "_autosummary/poli.core.util.default_observer", "_autosummary/poli.core.util.external_observer", "_autosummary/poli.core.util.external_observer.ExternalObserver", "_autosummary/poli.core.util.files", "_autosummary/poli.core.util.files.download_files_from_github", "_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository", "_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag", "_autosummary/poli.core.util.files.integrity", "_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath", "_autosummary/poli.core.util.inter_process_communication", "_autosummary/poli.core.util.inter_process_communication.process_wrapper", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection", "_autosummary/poli.core.util.isolation", "_autosummary/poli.core.util.isolation.external_black_box", "_autosummary/poli.core.util.isolation.external_function", "_autosummary/poli.core.util.isolation.instancing", "_autosummary/poli.core.util.isolation.isolated_black_box", "_autosummary/poli.core.util.multi_observer", "_autosummary/poli.core.util.objective_management", "_autosummary/poli.core.util.objective_management.make_run_script", "_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script", "_autosummary/poli.core.util.objective_management.make_run_script.make_run_script", "_autosummary/poli.core.util.observer_wrapper", "_autosummary/poli.core.util.observer_wrapper.start_observer_process", "_autosummary/poli.core.util.proteins", "_autosummary/poli.core.util.proteins.defaults", "_autosummary/poli.core.util.proteins.foldx", "_autosummary/poli.core.util.proteins.foldx.FoldxInterface", "_autosummary/poli.core.util.proteins.mutations", "_autosummary/poli.core.util.proteins.mutations.edits_between_strings", "_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant", "_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant", "_autosummary/poli.core.util.proteins.pdb_parsing", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure", "_autosummary/poli.core.util.proteins.rasp", "_autosummary/poli.core.util.proteins.rasp.inner_rasp", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization", "_autosummary/poli.core.util.proteins.rasp.load_models", "_autosummary/poli.core.util.proteins.rasp.rasp_interface", "_autosummary/poli.core.util.seeding", "_autosummary/poli.core.util.seeding.seeding", "_autosummary/poli.core.util.seeding.seeding.seed_numpy", "_autosummary/poli.core.util.seeding.seeding.seed_python", "_autosummary/poli.objective", "_autosummary/poli.objective.dynamically_instantiate", "_autosummary/poli.objective.parse_factory_kwargs", "_autosummary/poli.objective.run", "_autosummary/poli.objective_factory", "_autosummary/poli.objective_factory.ExternalBlackBox", "_autosummary/poli.objective_factory.create", "_autosummary/poli.objective_factory.load_config", "_autosummary/poli.objective_factory.start", "_autosummary/poli.objective_repository", "_autosummary/poli.objective_repository.albuterol_similarity", "_autosummary/poli.objective_repository.albuterol_similarity.information", "_autosummary/poli.objective_repository.albuterol_similarity.register", "_autosummary/poli.objective_repository.aloha", "_autosummary/poli.objective_repository.aloha.register", "_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox", "_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory", "_autosummary/poli.objective_repository.amlodipine_mpo", "_autosummary/poli.objective_repository.amlodipine_mpo.information", "_autosummary/poli.objective_repository.amlodipine_mpo.register", "_autosummary/poli.objective_repository.celecoxib_rediscovery", "_autosummary/poli.objective_repository.celecoxib_rediscovery.information", "_autosummary/poli.objective_repository.celecoxib_rediscovery.register", "_autosummary/poli.objective_repository.deco_hop", "_autosummary/poli.objective_repository.deco_hop.information", "_autosummary/poli.objective_repository.deco_hop.register", "_autosummary/poli.objective_repository.dockstring", "_autosummary/poli.objective_repository.dockstring.information", "_autosummary/poli.objective_repository.dockstring.isolated_function", "_autosummary/poli.objective_repository.dockstring.register", "_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox", "_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory", "_autosummary/poli.objective_repository.drd2_docking", "_autosummary/poli.objective_repository.drd2_docking.information", "_autosummary/poli.objective_repository.drd2_docking.register", "_autosummary/poli.objective_repository.drd3_docking", "_autosummary/poli.objective_repository.drd3_docking.information", "_autosummary/poli.objective_repository.drd3_docking.isolated_function", "_autosummary/poli.objective_repository.drd3_docking.register", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory", "_autosummary/poli.objective_repository.ehrlich", "_autosummary/poli.objective_repository.ehrlich.information", "_autosummary/poli.objective_repository.ehrlich.register", "_autosummary/poli.objective_repository.fexofenadine_mpo", "_autosummary/poli.objective_repository.fexofenadine_mpo.information", "_autosummary/poli.objective_repository.fexofenadine_mpo.register", "_autosummary/poli.objective_repository.foldx_rfp_lambo", "_autosummary/poli.objective_repository.foldx_rfp_lambo.information", "_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config", "_autosummary/poli.objective_repository.foldx_sasa", "_autosummary/poli.objective_repository.foldx_sasa.foldx_utils", "_autosummary/poli.objective_repository.foldx_sasa.information", "_autosummary/poli.objective_repository.foldx_sasa.isolated_function", "_autosummary/poli.objective_repository.foldx_sasa.register", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory", "_autosummary/poli.objective_repository.foldx_stability", "_autosummary/poli.objective_repository.foldx_stability.foldx_utils", "_autosummary/poli.objective_repository.foldx_stability.information", "_autosummary/poli.objective_repository.foldx_stability.isolated_function", "_autosummary/poli.objective_repository.foldx_stability.register", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory", "_autosummary/poli.objective_repository.foldx_stability_and_sasa", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.information", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory", "_autosummary/poli.objective_repository.gfp_cbas", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder", "_autosummary/poli.objective_repository.gfp_cbas.gfp_gp", "_autosummary/poli.objective_repository.gfp_cbas.information", "_autosummary/poli.objective_repository.gfp_cbas.isolated_function", "_autosummary/poli.objective_repository.gfp_cbas.make_vae", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy", "_autosummary/poli.objective_repository.gfp_cbas.register", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory", "_autosummary/poli.objective_repository.gfp_select", "_autosummary/poli.objective_repository.gfp_select.information", "_autosummary/poli.objective_repository.gfp_select.isolated_function", "_autosummary/poli.objective_repository.gfp_select.register", "_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox", "_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory", "_autosummary/poli.objective_repository.gsk3_beta", "_autosummary/poli.objective_repository.gsk3_beta.information", "_autosummary/poli.objective_repository.gsk3_beta.register", "_autosummary/poli.objective_repository.isomer_c7h8n2o2", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.information", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.register", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register", "_autosummary/poli.objective_repository.jnk3", "_autosummary/poli.objective_repository.jnk3.information", "_autosummary/poli.objective_repository.jnk3.register", "_autosummary/poli.objective_repository.median_1", "_autosummary/poli.objective_repository.median_1.information", "_autosummary/poli.objective_repository.median_1.register", "_autosummary/poli.objective_repository.median_2", "_autosummary/poli.objective_repository.median_2.information", "_autosummary/poli.objective_repository.median_2.register", "_autosummary/poli.objective_repository.mestranol_similarity", "_autosummary/poli.objective_repository.mestranol_similarity.information", "_autosummary/poli.objective_repository.mestranol_similarity.register", "_autosummary/poli.objective_repository.osimetrinib_mpo", "_autosummary/poli.objective_repository.osimetrinib_mpo.information", "_autosummary/poli.objective_repository.osimetrinib_mpo.register", "_autosummary/poli.objective_repository.penalized_logp_lambo", "_autosummary/poli.objective_repository.penalized_logp_lambo.information", "_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function", "_autosummary/poli.objective_repository.penalized_logp_lambo.register", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory", "_autosummary/poli.objective_repository.perindopril_mpo", "_autosummary/poli.objective_repository.perindopril_mpo.information", "_autosummary/poli.objective_repository.perindopril_mpo.register", "_autosummary/poli.objective_repository.ranolazine_mpo", "_autosummary/poli.objective_repository.ranolazine_mpo.information", "_autosummary/poli.objective_repository.ranolazine_mpo.register", "_autosummary/poli.objective_repository.rasp", "_autosummary/poli.objective_repository.rasp.information", "_autosummary/poli.objective_repository.rasp.isolated_function", "_autosummary/poli.objective_repository.rasp.register", "_autosummary/poli.objective_repository.rdkit_logp", "_autosummary/poli.objective_repository.rdkit_logp.information", "_autosummary/poli.objective_repository.rdkit_logp.register", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory", "_autosummary/poli.objective_repository.rdkit_qed", "_autosummary/poli.objective_repository.rdkit_qed.information", "_autosummary/poli.objective_repository.rdkit_qed.register", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register", "_autosummary/poli.objective_repository.rmf_landscape", "_autosummary/poli.objective_repository.rmf_landscape.information", "_autosummary/poli.objective_repository.rmf_landscape.isolated_function", "_autosummary/poli.objective_repository.rmf_landscape.register", "_autosummary/poli.objective_repository.sa_tdc", "_autosummary/poli.objective_repository.sa_tdc.information", "_autosummary/poli.objective_repository.sa_tdc.isolated_function", "_autosummary/poli.objective_repository.sa_tdc.register", "_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox", "_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory", "_autosummary/poli.objective_repository.scaffold_hop", "_autosummary/poli.objective_repository.scaffold_hop.information", "_autosummary/poli.objective_repository.scaffold_hop.register", "_autosummary/poli.objective_repository.sitagliptin_mpo", "_autosummary/poli.objective_repository.sitagliptin_mpo.information", "_autosummary/poli.objective_repository.sitagliptin_mpo.register", "_autosummary/poli.objective_repository.super_mario_bros", "_autosummary/poli.objective_repository.super_mario_bros.information", "_autosummary/poli.objective_repository.super_mario_bros.level_utils", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized", "_autosummary/poli.objective_repository.super_mario_bros.model", "_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario", "_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model", "_autosummary/poli.objective_repository.super_mario_bros.register", "_autosummary/poli.objective_repository.thiothixene_rediscovery", "_autosummary/poli.objective_repository.thiothixene_rediscovery.information", "_autosummary/poli.objective_repository.thiothixene_rediscovery.register", "_autosummary/poli.objective_repository.toy_continuous_problem", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang", "_autosummary/poli.objective_repository.toy_continuous_problem.information", "_autosummary/poli.objective_repository.toy_continuous_problem.register", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem", "_autosummary/poli.objective_repository.troglitazone_rediscovery", "_autosummary/poli.objective_repository.troglitazone_rediscovery.information", "_autosummary/poli.objective_repository.troglitazone_rediscovery.register", "_autosummary/poli.objective_repository.valsartan_smarts", "_autosummary/poli.objective_repository.valsartan_smarts.information", "_autosummary/poli.objective_repository.valsartan_smarts.register", "_autosummary/poli.objective_repository.white_noise", "_autosummary/poli.objective_repository.white_noise.register", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory", "_autosummary/poli.objective_repository.zaleplon_mpo", "_autosummary/poli.objective_repository.zaleplon_mpo.information", "_autosummary/poli.objective_repository.zaleplon_mpo.register", "_autosummary/poli.registered_objectives", "_autosummary/poli.tests", "_autosummary/poli.tests.benchmarks", "_autosummary/poli.tests.benchmarks.test_benchmark_creation", "_autosummary/poli.tests.conftest", "_autosummary/poli.tests.docs_examples", "_autosummary/poli.tests.docs_examples.test_objective_functions", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example", "_autosummary/poli.tests.information", "_autosummary/poli.tests.information.test_dynamic_information", "_autosummary/poli.tests.registry", "_autosummary/poli.tests.registry.basic_objectives", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise", "_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion", "_autosummary/poli.tests.registry.chemistry", "_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives", "_autosummary/poli.tests.registry.proteins", "_autosummary/poli.tests.registry.proteins.test_foldx", "_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo", "_autosummary/poli.tests.registry.proteins.test_rasp", "_autosummary/poli.tests.registry.test_basic_loop_without_create", "_autosummary/poli.tests.registry.test_black_box_instancing", "_autosummary/poli.tests.registry.test_force_isolation", "_autosummary/poli.tests.registry.test_instancing_black_boxes_alone", "_autosummary/poli.tests.registry.test_multi_objective_and_negative", "_autosummary/poli.tests.registry.test_passing_array_of_strings", "_autosummary/poli.tests.registry.toy_continuous_problems", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions", "_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems", "_autosummary/poli.tests.registry.toy_discrete_problems", "_autosummary/poli.tests.test_core_promises", "_autosummary/poli.tests.test_minimal_working_example", "_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example", "_autosummary/poli.tests.test_seeding", "_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise", "_autosummary/poli.tests.util", "_autosummary/poli.tests.util.test_foldx_interface", "_autosummary/poli.tests.util.test_protein_utilities", "_templates/custom-module-template", "api", "bibliography", "contributing/a_new_problem", "contributing/a_new_solver", "getting_started/getting_started", "index", "understanding_foldx/00-installing-foldx", "understanding_foldx/01-single-mutation-using-foldx/index", "using_poli/objective_repository/RaSP", "using_poli/objective_repository/albuterol_similarity", "using_poli/objective_repository/all_objectives", "using_poli/objective_repository/aloha", "using_poli/objective_repository/amlodipine_mpo", "using_poli/objective_repository/celecoxib_rediscovery", "using_poli/objective_repository/deco_hop", "using_poli/objective_repository/dockstring", "using_poli/objective_repository/drd2_docking", "using_poli/objective_repository/drd3_docking", "using_poli/objective_repository/ehrlich_functions", "using_poli/objective_repository/fexofenadine_mpo", "using_poli/objective_repository/foldx_rfp_lambo", "using_poli/objective_repository/foldx_sasa", "using_poli/objective_repository/foldx_stability", "using_poli/objective_repository/gsk3_beta", "using_poli/objective_repository/isomer_c7h8n2o2", "using_poli/objective_repository/isomer_c9h10n2o2pf2cl", "using_poli/objective_repository/jnk3", "using_poli/objective_repository/median_1", "using_poli/objective_repository/median_2", "using_poli/objective_repository/mestranol_similarity", "using_poli/objective_repository/osimetrinib_mpo", "using_poli/objective_repository/penalized_logp_lambo", "using_poli/objective_repository/ranolazine_mpo", "using_poli/objective_repository/rdkit_logp", "using_poli/objective_repository/rdkit_qed", "using_poli/objective_repository/sa_tdc", "using_poli/objective_repository/scaffold_hop", "using_poli/objective_repository/sitagliptin_mpo", "using_poli/objective_repository/super_mario_bros", "using_poli/objective_repository/template", "using_poli/objective_repository/thiothixene_rediscovery", "using_poli/objective_repository/toy_continuous_problems", "using_poli/objective_repository/troglitazone_rediscovery", "using_poli/objective_repository/valsartan_smarts", "using_poli/objective_repository/white_noise", "using_poli/objective_repository/zaleplon_mpo", "using_poli/observers/registering_an_observer", "using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability", "using_poli/the_basics/defining_a_problem_solver", "using_poli/the_basics/defining_an_observer", "using_poli/the_basics/diving_deeper", "using_poli/the_basics/intro_to_poli", "using_poli/the_basics/isolation", "using_poli_baselines/alebo", "using_poli_baselines/baxus", "using_poli_baselines/bayesian_optimization", "using_poli_baselines/bounce", "using_poli_baselines/cma_es", "using_poli_baselines/graph_ga", "using_poli_baselines/hvarfners_vanilla_bo", "using_poli_baselines/lambo2", "using_poli_baselines/latent_space_bo", "using_poli_baselines/line_bayesian_optimization", "using_poli_baselines/nsga_2", "using_poli_baselines/probrep", "using_poli_baselines/random_mutations", "using_poli_baselines/saasbo", "using_poli_baselines/template", "using_poli_baselines/turbo"], "filenames": ["_autosummary/poli.rst", "_autosummary/poli.core.rst", "_autosummary/poli.core.abstract_benchmark.rst", "_autosummary/poli.core.abstract_black_box.rst", "_autosummary/poli.core.abstract_black_box.AbstractBlackBox.rst", "_autosummary/poli.core.abstract_black_box.NegativeBlackBox.rst", "_autosummary/poli.core.abstract_isolated_function.rst", "_autosummary/poli.core.abstract_problem_factory.rst", "_autosummary/poli.core.abstract_problem_factory.AbstractProblemFactory.rst", "_autosummary/poli.core.abstract_problem_factory.MetaProblemFactory.rst", "_autosummary/poli.core.benchmark_information.rst", "_autosummary/poli.core.black_box_information.rst", "_autosummary/poli.core.chemistry.rst", "_autosummary/poli.core.chemistry.tdc_black_box.rst", "_autosummary/poli.core.chemistry.tdc_black_box.TDCBlackBox.rst", "_autosummary/poli.core.chemistry.tdc_isolated_function.rst", "_autosummary/poli.core.exceptions.rst", "_autosummary/poli.core.exceptions.BudgetExhaustedException.rst", "_autosummary/poli.core.exceptions.PoliException.rst", "_autosummary/poli.core.multi_objective_black_box.rst", "_autosummary/poli.core.multi_objective_black_box.MultiObjectiveBlackBox.rst", "_autosummary/poli.core.problem.rst", "_autosummary/poli.core.problem_setup_information.rst", "_autosummary/poli.core.problem_setup_information.ProblemSetupInformation.rst", "_autosummary/poli.core.proteins.rst", "_autosummary/poli.core.proteins.foldx_black_box.rst", "_autosummary/poli.core.proteins.foldx_black_box.FoldxBlackBox.rst", "_autosummary/poli.core.proteins.foldx_isolated_function.rst", "_autosummary/poli.core.registry.rst", "_autosummary/poli.core.registry.delete_observer_run_script.rst", "_autosummary/poli.core.registry.delete_problem.rst", "_autosummary/poli.core.registry.get_problem_factories.rst", "_autosummary/poli.core.registry.get_problems.rst", "_autosummary/poli.core.registry.register_problem.rst", "_autosummary/poli.core.registry.register_problem_from_repository.rst", "_autosummary/poli.core.registry.set_observer.rst", "_autosummary/poli.core.registry.set_observer_run_script.rst", "_autosummary/poli.core.util.rst", "_autosummary/poli.core.util.abstract_observer.rst", "_autosummary/poli.core.util.abstract_observer.AbstractObserver.rst", "_autosummary/poli.core.util.algorithm_observer_wrapper.rst", "_autosummary/poli.core.util.alignment.rst", "_autosummary/poli.core.util.alignment.is_aligned.rst", "_autosummary/poli.core.util.batch.rst", "_autosummary/poli.core.util.batch.batch_input.rst", "_autosummary/poli.core.util.batch.batch_input.batched.rst", "_autosummary/poli.core.util.chemistry.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.selfies_to_molecules.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.smiles_to_molecules.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.strings_to_molecules.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles.rst", "_autosummary/poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies.rst", "_autosummary/poli.core.util.default_observer.rst", "_autosummary/poli.core.util.external_observer.rst", "_autosummary/poli.core.util.external_observer.ExternalObserver.rst", "_autosummary/poli.core.util.files.rst", "_autosummary/poli.core.util.files.download_files_from_github.rst", "_autosummary/poli.core.util.files.download_files_from_github.download_file_from_github_repository.rst", "_autosummary/poli.core.util.files.download_files_from_github.get_sha_for_tag.rst", "_autosummary/poli.core.util.files.integrity.rst", "_autosummary/poli.core.util.files.integrity.compute_md5_from_filepath.rst", "_autosummary/poli.core.util.inter_process_communication.rst", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.rst", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper.rst", "_autosummary/poli.core.util.inter_process_communication.process_wrapper.get_connection.rst", "_autosummary/poli.core.util.isolation.rst", "_autosummary/poli.core.util.isolation.external_black_box.rst", "_autosummary/poli.core.util.isolation.external_function.rst", "_autosummary/poli.core.util.isolation.instancing.rst", "_autosummary/poli.core.util.isolation.isolated_black_box.rst", "_autosummary/poli.core.util.multi_observer.rst", "_autosummary/poli.core.util.objective_management.rst", "_autosummary/poli.core.util.objective_management.make_run_script.rst", "_autosummary/poli.core.util.objective_management.make_run_script.make_observer_script.rst", "_autosummary/poli.core.util.objective_management.make_run_script.make_run_script.rst", "_autosummary/poli.core.util.observer_wrapper.rst", "_autosummary/poli.core.util.observer_wrapper.start_observer_process.rst", "_autosummary/poli.core.util.proteins.rst", "_autosummary/poli.core.util.proteins.defaults.rst", "_autosummary/poli.core.util.proteins.foldx.rst", "_autosummary/poli.core.util.proteins.foldx.FoldxInterface.rst", "_autosummary/poli.core.util.proteins.mutations.rst", "_autosummary/poli.core.util.proteins.mutations.edits_between_strings.rst", "_autosummary/poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant.rst", "_autosummary/poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues.rst", "_autosummary/poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure.rst", "_autosummary/poli.core.util.proteins.rasp.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.PrismData.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.cavity_model.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.helpers.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.run_pipeline.rst", "_autosummary/poli.core.util.proteins.rasp.inner_rasp.visualization.rst", "_autosummary/poli.core.util.proteins.rasp.load_models.rst", "_autosummary/poli.core.util.proteins.rasp.rasp_interface.rst", "_autosummary/poli.core.util.seeding.rst", "_autosummary/poli.core.util.seeding.seeding.rst", "_autosummary/poli.core.util.seeding.seeding.seed_numpy.rst", "_autosummary/poli.core.util.seeding.seeding.seed_python.rst", "_autosummary/poli.objective.rst", "_autosummary/poli.objective.dynamically_instantiate.rst", "_autosummary/poli.objective.parse_factory_kwargs.rst", "_autosummary/poli.objective.run.rst", "_autosummary/poli.objective_factory.rst", "_autosummary/poli.objective_factory.ExternalBlackBox.rst", "_autosummary/poli.objective_factory.create.rst", "_autosummary/poli.objective_factory.load_config.rst", "_autosummary/poli.objective_factory.start.rst", "_autosummary/poli.objective_repository.rst", "_autosummary/poli.objective_repository.albuterol_similarity.rst", "_autosummary/poli.objective_repository.albuterol_similarity.information.rst", "_autosummary/poli.objective_repository.albuterol_similarity.register.rst", "_autosummary/poli.objective_repository.aloha.rst", "_autosummary/poli.objective_repository.aloha.register.rst", "_autosummary/poli.objective_repository.aloha.register.AlohaBlackBox.rst", "_autosummary/poli.objective_repository.aloha.register.AlohaProblemFactory.rst", "_autosummary/poli.objective_repository.amlodipine_mpo.rst", "_autosummary/poli.objective_repository.amlodipine_mpo.information.rst", "_autosummary/poli.objective_repository.amlodipine_mpo.register.rst", "_autosummary/poli.objective_repository.celecoxib_rediscovery.rst", "_autosummary/poli.objective_repository.celecoxib_rediscovery.information.rst", "_autosummary/poli.objective_repository.celecoxib_rediscovery.register.rst", "_autosummary/poli.objective_repository.deco_hop.rst", "_autosummary/poli.objective_repository.deco_hop.information.rst", "_autosummary/poli.objective_repository.deco_hop.register.rst", "_autosummary/poli.objective_repository.dockstring.rst", "_autosummary/poli.objective_repository.dockstring.information.rst", "_autosummary/poli.objective_repository.dockstring.isolated_function.rst", "_autosummary/poli.objective_repository.dockstring.register.rst", "_autosummary/poli.objective_repository.dockstring.register.DockstringBlackBox.rst", "_autosummary/poli.objective_repository.dockstring.register.DockstringProblemFactory.rst", "_autosummary/poli.objective_repository.drd2_docking.rst", "_autosummary/poli.objective_repository.drd2_docking.information.rst", "_autosummary/poli.objective_repository.drd2_docking.register.rst", "_autosummary/poli.objective_repository.drd3_docking.rst", "_autosummary/poli.objective_repository.drd3_docking.information.rst", "_autosummary/poli.objective_repository.drd3_docking.isolated_function.rst", "_autosummary/poli.objective_repository.drd3_docking.register.rst", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3BlackBox.rst", "_autosummary/poli.objective_repository.drd3_docking.register.DRD3ProblemFactory.rst", "_autosummary/poli.objective_repository.ehrlich.rst", "_autosummary/poli.objective_repository.ehrlich.information.rst", "_autosummary/poli.objective_repository.ehrlich.register.rst", "_autosummary/poli.objective_repository.fexofenadine_mpo.rst", "_autosummary/poli.objective_repository.fexofenadine_mpo.information.rst", "_autosummary/poli.objective_repository.fexofenadine_mpo.register.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.information.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.Config.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory.rst", "_autosummary/poli.objective_repository.foldx_rfp_lambo.register.get_config.rst", "_autosummary/poli.objective_repository.foldx_sasa.rst", "_autosummary/poli.objective_repository.foldx_sasa.foldx_utils.rst", "_autosummary/poli.objective_repository.foldx_sasa.information.rst", "_autosummary/poli.objective_repository.foldx_sasa.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_sasa.register.rst", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox.rst", "_autosummary/poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory.rst", "_autosummary/poli.objective_repository.foldx_stability.rst", "_autosummary/poli.objective_repository.foldx_stability.foldx_utils.rst", "_autosummary/poli.objective_repository.foldx_stability.information.rst", "_autosummary/poli.objective_repository.foldx_stability.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_stability.register.rst", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox.rst", "_autosummary/poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.information.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.isolated_function.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox.rst", "_autosummary/poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory.rst", "_autosummary/poli.objective_repository.gfp_cbas.rst", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder.rst", "_autosummary/poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder.rst", "_autosummary/poli.objective_repository.gfp_cbas.gfp_gp.rst", "_autosummary/poli.objective_repository.gfp_cbas.information.rst", "_autosummary/poli.objective_repository.gfp_cbas.isolated_function.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.BaseVAE.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.SimpleVAE.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.build_vae.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.identity_loss.rst", "_autosummary/poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy.rst", "_autosummary/poli.objective_repository.gfp_cbas.register.rst", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox.rst", "_autosummary/poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory.rst", "_autosummary/poli.objective_repository.gfp_select.rst", "_autosummary/poli.objective_repository.gfp_select.information.rst", "_autosummary/poli.objective_repository.gfp_select.isolated_function.rst", "_autosummary/poli.objective_repository.gfp_select.register.rst", "_autosummary/poli.objective_repository.gfp_select.register.GFPBlackBox.rst", "_autosummary/poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory.rst", "_autosummary/poli.objective_repository.gsk3_beta.rst", "_autosummary/poli.objective_repository.gsk3_beta.information.rst", "_autosummary/poli.objective_repository.gsk3_beta.register.rst", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.rst", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.information.rst", "_autosummary/poli.objective_repository.isomer_c7h8n2o2.register.rst", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.rst", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.information.rst", "_autosummary/poli.objective_repository.isomer_c9h10n2o2pf2cl.register.rst", "_autosummary/poli.objective_repository.jnk3.rst", "_autosummary/poli.objective_repository.jnk3.information.rst", "_autosummary/poli.objective_repository.jnk3.register.rst", "_autosummary/poli.objective_repository.median_1.rst", "_autosummary/poli.objective_repository.median_1.information.rst", "_autosummary/poli.objective_repository.median_1.register.rst", "_autosummary/poli.objective_repository.median_2.rst", "_autosummary/poli.objective_repository.median_2.information.rst", "_autosummary/poli.objective_repository.median_2.register.rst", "_autosummary/poli.objective_repository.mestranol_similarity.rst", "_autosummary/poli.objective_repository.mestranol_similarity.information.rst", "_autosummary/poli.objective_repository.mestranol_similarity.register.rst", "_autosummary/poli.objective_repository.osimetrinib_mpo.rst", "_autosummary/poli.objective_repository.osimetrinib_mpo.information.rst", "_autosummary/poli.objective_repository.osimetrinib_mpo.register.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.information.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.isolated_function.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox.rst", "_autosummary/poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory.rst", "_autosummary/poli.objective_repository.perindopril_mpo.rst", "_autosummary/poli.objective_repository.perindopril_mpo.information.rst", "_autosummary/poli.objective_repository.perindopril_mpo.register.rst", "_autosummary/poli.objective_repository.ranolazine_mpo.rst", "_autosummary/poli.objective_repository.ranolazine_mpo.information.rst", "_autosummary/poli.objective_repository.ranolazine_mpo.register.rst", "_autosummary/poli.objective_repository.rasp.rst", "_autosummary/poli.objective_repository.rasp.information.rst", "_autosummary/poli.objective_repository.rasp.isolated_function.rst", "_autosummary/poli.objective_repository.rasp.register.rst", "_autosummary/poli.objective_repository.rdkit_logp.rst", "_autosummary/poli.objective_repository.rdkit_logp.information.rst", "_autosummary/poli.objective_repository.rdkit_logp.register.rst", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPBlackBox.rst", "_autosummary/poli.objective_repository.rdkit_logp.register.LogPProblemFactory.rst", "_autosummary/poli.objective_repository.rdkit_qed.rst", "_autosummary/poli.objective_repository.rdkit_qed.information.rst", "_autosummary/poli.objective_repository.rdkit_qed.register.rst", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDBlackBox.rst", "_autosummary/poli.objective_repository.rdkit_qed.register.QEDProblemFactory.rst", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.rst", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.information.rst", "_autosummary/poli.objective_repository.rfp_foldx_stability_and_sasa.register.rst", "_autosummary/poli.objective_repository.rmf_landscape.rst", "_autosummary/poli.objective_repository.rmf_landscape.information.rst", "_autosummary/poli.objective_repository.rmf_landscape.isolated_function.rst", "_autosummary/poli.objective_repository.rmf_landscape.register.rst", "_autosummary/poli.objective_repository.sa_tdc.rst", "_autosummary/poli.objective_repository.sa_tdc.information.rst", "_autosummary/poli.objective_repository.sa_tdc.isolated_function.rst", "_autosummary/poli.objective_repository.sa_tdc.register.rst", "_autosummary/poli.objective_repository.sa_tdc.register.SABlackBox.rst", "_autosummary/poli.objective_repository.sa_tdc.register.SAProblemFactory.rst", "_autosummary/poli.objective_repository.scaffold_hop.rst", "_autosummary/poli.objective_repository.scaffold_hop.information.rst", "_autosummary/poli.objective_repository.scaffold_hop.register.rst", "_autosummary/poli.objective_repository.sitagliptin_mpo.rst", "_autosummary/poli.objective_repository.sitagliptin_mpo.information.rst", "_autosummary/poli.objective_repository.sitagliptin_mpo.register.rst", "_autosummary/poli.objective_repository.super_mario_bros.rst", "_autosummary/poli.objective_repository.super_mario_bros.information.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.clean_level.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_array.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.level_to_list.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level.rst", "_autosummary/poli.objective_repository.super_mario_bros.level_utils.vectorized.rst", "_autosummary/poli.objective_repository.super_mario_bros.model.rst", "_autosummary/poli.objective_repository.super_mario_bros.model.VAEMario.rst", "_autosummary/poli.objective_repository.super_mario_bros.model.load_example_model.rst", "_autosummary/poli.objective_repository.super_mario_bros.register.rst", "_autosummary/poli.objective_repository.thiothixene_rediscovery.rst", "_autosummary/poli.objective_repository.thiothixene_rediscovery.information.rst", "_autosummary/poli.objective_repository.thiothixene_rediscovery.register.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_01.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.alpine_02.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.bent_cigar.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.brown.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.camelback_2d.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_01.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deb_02.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.easom.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.egg_holder.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.information.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.register.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.rst", "_autosummary/poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem.rst", "_autosummary/poli.objective_repository.troglitazone_rediscovery.rst", "_autosummary/poli.objective_repository.troglitazone_rediscovery.information.rst", "_autosummary/poli.objective_repository.troglitazone_rediscovery.register.rst", "_autosummary/poli.objective_repository.valsartan_smarts.rst", "_autosummary/poli.objective_repository.valsartan_smarts.information.rst", "_autosummary/poli.objective_repository.valsartan_smarts.register.rst", "_autosummary/poli.objective_repository.white_noise.rst", "_autosummary/poli.objective_repository.white_noise.register.rst", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseBlackBox.rst", "_autosummary/poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory.rst", "_autosummary/poli.objective_repository.zaleplon_mpo.rst", "_autosummary/poli.objective_repository.zaleplon_mpo.information.rst", "_autosummary/poli.objective_repository.zaleplon_mpo.register.rst", "_autosummary/poli.registered_objectives.rst", "_autosummary/poli.tests.rst", "_autosummary/poli.tests.benchmarks.rst", "_autosummary/poli.tests.benchmarks.test_benchmark_creation.rst", "_autosummary/poli.tests.conftest.rst", "_autosummary/poli.tests.docs_examples.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_aloha_example.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings.rst", "_autosummary/poli.tests.docs_examples.test_objective_functions.test_white_noise_example.rst", "_autosummary/poli.tests.information.rst", "_autosummary/poli.tests.information.test_dynamic_information.rst", "_autosummary/poli.tests.registry.rst", "_autosummary/poli.tests.registry.basic_objectives.rst", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.rst", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha.rst", "_autosummary/poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise.rst", "_autosummary/poli.tests.registry.basic_objectives.test_budget_exhaustion.rst", "_autosummary/poli.tests.registry.chemistry.rst", "_autosummary/poli.tests.registry.chemistry.test_chemistry_objectives.rst", "_autosummary/poli.tests.registry.proteins.rst", "_autosummary/poli.tests.registry.proteins.test_foldx.rst", "_autosummary/poli.tests.registry.proteins.test_foldx_rfp_lambo.rst", "_autosummary/poli.tests.registry.proteins.test_rasp.rst", "_autosummary/poli.tests.registry.test_basic_loop_without_create.rst", "_autosummary/poli.tests.registry.test_black_box_instancing.rst", "_autosummary/poli.tests.registry.test_force_isolation.rst", "_autosummary/poli.tests.registry.test_instancing_black_boxes_alone.rst", "_autosummary/poli.tests.registry.test_multi_objective_and_negative.rst", "_autosummary/poli.tests.registry.test_passing_array_of_strings.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions.rst", "_autosummary/poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems.rst", "_autosummary/poli.tests.registry.toy_discrete_problems.rst", "_autosummary/poli.tests.test_core_promises.rst", "_autosummary/poli.tests.test_minimal_working_example.rst", "_autosummary/poli.tests.test_minimal_working_example.test_minimal_working_example.rst", "_autosummary/poli.tests.test_seeding.rst", "_autosummary/poli.tests.test_seeding.test_seeding_in_white_noise.rst", "_autosummary/poli.tests.util.rst", "_autosummary/poli.tests.util.test_foldx_interface.rst", "_autosummary/poli.tests.util.test_protein_utilities.rst", "_templates/custom-module-template.rst", "api.rst", "bibliography.md", "contributing/a_new_problem.md", "contributing/a_new_solver.md", "getting_started/getting_started.md", "index.md", "understanding_foldx/00-installing-foldx.md", "understanding_foldx/01-single-mutation-using-foldx/index.ipynb", "using_poli/objective_repository/RaSP.md", "using_poli/objective_repository/albuterol_similarity.md", "using_poli/objective_repository/all_objectives.md", "using_poli/objective_repository/aloha.md", "using_poli/objective_repository/amlodipine_mpo.md", "using_poli/objective_repository/celecoxib_rediscovery.md", "using_poli/objective_repository/deco_hop.md", "using_poli/objective_repository/dockstring.md", "using_poli/objective_repository/drd2_docking.md", "using_poli/objective_repository/drd3_docking.md", "using_poli/objective_repository/ehrlich_functions.md", "using_poli/objective_repository/fexofenadine_mpo.md", "using_poli/objective_repository/foldx_rfp_lambo.md", "using_poli/objective_repository/foldx_sasa.md", "using_poli/objective_repository/foldx_stability.md", "using_poli/objective_repository/gsk3_beta.md", "using_poli/objective_repository/isomer_c7h8n2o2.md", "using_poli/objective_repository/isomer_c9h10n2o2pf2cl.md", "using_poli/objective_repository/jnk3.md", "using_poli/objective_repository/median_1.md", "using_poli/objective_repository/median_2.md", "using_poli/objective_repository/mestranol_similarity.md", "using_poli/objective_repository/osimetrinib_mpo.md", "using_poli/objective_repository/penalized_logp_lambo.md", "using_poli/objective_repository/ranolazine_mpo.md", "using_poli/objective_repository/rdkit_logp.md", "using_poli/objective_repository/rdkit_qed.md", "using_poli/objective_repository/sa_tdc.md", "using_poli/objective_repository/scaffold_hop.md", "using_poli/objective_repository/sitagliptin_mpo.md", "using_poli/objective_repository/super_mario_bros.md", "using_poli/objective_repository/template.md", "using_poli/objective_repository/thiothixene_rediscovery.md", "using_poli/objective_repository/toy_continuous_problems.md", "using_poli/objective_repository/troglitazone_rediscovery.md", "using_poli/objective_repository/valsartan_smarts.md", "using_poli/objective_repository/white_noise.md", "using_poli/objective_repository/zaleplon_mpo.md", "using_poli/observers/registering_an_observer.md", "using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability.ipynb", "using_poli/the_basics/defining_a_problem_solver.md", "using_poli/the_basics/defining_an_observer.ipynb", "using_poli/the_basics/diving_deeper.md", "using_poli/the_basics/intro_to_poli.ipynb", "using_poli/the_basics/isolation.ipynb", "using_poli_baselines/alebo.md", "using_poli_baselines/baxus.md", "using_poli_baselines/bayesian_optimization.md", "using_poli_baselines/bounce.md", "using_poli_baselines/cma_es.md", "using_poli_baselines/graph_ga.md", "using_poli_baselines/hvarfners_vanilla_bo.md", "using_poli_baselines/lambo2.md", "using_poli_baselines/latent_space_bo.md", "using_poli_baselines/line_bayesian_optimization.md", "using_poli_baselines/nsga_2.md", "using_poli_baselines/probrep.md", "using_poli_baselines/random_mutations.md", "using_poli_baselines/saasbo.md", "using_poli_baselines/template.md", "using_poli_baselines/turbo.md"], "titles": ["poli", "poli.core", "poli.core.abstract_benchmark", "poli.core.abstract_black_box", "poli.core.abstract_black_box.AbstractBlackBox", "poli.core.abstract_black_box.NegativeBlackBox", "poli.core.abstract_isolated_function", "poli.core.abstract_problem_factory", "poli.core.abstract_problem_factory.AbstractProblemFactory", "poli.core.abstract_problem_factory.MetaProblemFactory", "poli.core.benchmark_information", "poli.core.black_box_information", "poli.core.chemistry", "poli.core.chemistry.tdc_black_box", "poli.core.chemistry.tdc_black_box.TDCBlackBox", "poli.core.chemistry.tdc_isolated_function", "poli.core.exceptions", "poli.core.exceptions.BudgetExhaustedException", "poli.core.exceptions.PoliException", "poli.core.multi_objective_black_box", "poli.core.multi_objective_black_box.MultiObjectiveBlackBox", "poli.core.problem", "poli.core.problem_setup_information", "poli.core.problem_setup_information.ProblemSetupInformation", "poli.core.proteins", "poli.core.proteins.foldx_black_box", "poli.core.proteins.foldx_black_box.FoldxBlackBox", "poli.core.proteins.foldx_isolated_function", "poli.core.registry", "poli.core.registry.delete_observer_run_script", "poli.core.registry.delete_problem", "poli.core.registry.get_problem_factories", "poli.core.registry.get_problems", "poli.core.registry.register_problem", "poli.core.registry.register_problem_from_repository", "poli.core.registry.set_observer", "poli.core.registry.set_observer_run_script", "poli.core.util", "poli.core.util.abstract_observer", "poli.core.util.abstract_observer.AbstractObserver", "poli.core.util.algorithm_observer_wrapper", "poli.core.util.alignment", "poli.core.util.alignment.is_aligned", "poli.core.util.batch", "poli.core.util.batch.batch_input", "poli.core.util.batch.batch_input.batched", "poli.core.util.chemistry", "poli.core.util.chemistry.string_to_molecule", "poli.core.util.chemistry.string_to_molecule.selfies_to_molecules", "poli.core.util.chemistry.string_to_molecule.smiles_to_molecules", "poli.core.util.chemistry.string_to_molecule.strings_to_molecules", "poli.core.util.chemistry.string_to_molecule.translate_selfies_to_smiles", "poli.core.util.chemistry.string_to_molecule.translate_smiles_to_selfies", "poli.core.util.default_observer", "poli.core.util.external_observer", "poli.core.util.external_observer.ExternalObserver", "poli.core.util.files", "poli.core.util.files.download_files_from_github", "poli.core.util.files.download_files_from_github.download_file_from_github_repository", "poli.core.util.files.download_files_from_github.get_sha_for_tag", "poli.core.util.files.integrity", "poli.core.util.files.integrity.compute_md5_from_filepath", "poli.core.util.inter_process_communication", "poli.core.util.inter_process_communication.process_wrapper", "poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper", "poli.core.util.inter_process_communication.process_wrapper.get_connection", "poli.core.util.isolation", "poli.core.util.isolation.external_black_box", "poli.core.util.isolation.external_function", "poli.core.util.isolation.instancing", "poli.core.util.isolation.isolated_black_box", "poli.core.util.multi_observer", "poli.core.util.objective_management", "poli.core.util.objective_management.make_run_script", "poli.core.util.objective_management.make_run_script.make_observer_script", "poli.core.util.objective_management.make_run_script.make_run_script", "poli.core.util.observer_wrapper", "poli.core.util.observer_wrapper.start_observer_process", "poli.core.util.proteins", "poli.core.util.proteins.defaults", "poli.core.util.proteins.foldx", "poli.core.util.proteins.foldx.FoldxInterface", "poli.core.util.proteins.mutations", "poli.core.util.proteins.mutations.edits_between_strings", "poli.core.util.proteins.mutations.find_closest_wildtype_pdb_file_to_mutant", "poli.core.util.proteins.mutations.mutations_from_wildtype_residues_and_mutant", "poli.core.util.proteins.pdb_parsing", "poli.core.util.proteins.pdb_parsing.parse_pdb_as_residue_strings", "poli.core.util.proteins.pdb_parsing.parse_pdb_as_residues", "poli.core.util.proteins.pdb_parsing.parse_pdb_as_structure", "poli.core.util.proteins.rasp", "poli.core.util.proteins.rasp.inner_rasp", "poli.core.util.proteins.rasp.inner_rasp.PrismData", "poli.core.util.proteins.rasp.inner_rasp.cavity_model", "poli.core.util.proteins.rasp.inner_rasp.helpers", "poli.core.util.proteins.rasp.inner_rasp.run_pipeline", "poli.core.util.proteins.rasp.inner_rasp.visualization", "poli.core.util.proteins.rasp.load_models", "poli.core.util.proteins.rasp.rasp_interface", "poli.core.util.seeding", "poli.core.util.seeding.seeding", "poli.core.util.seeding.seeding.seed_numpy", "poli.core.util.seeding.seeding.seed_python", "poli.objective", "poli.objective.dynamically_instantiate", "poli.objective.parse_factory_kwargs", "poli.objective.run", "poli.objective_factory", "poli.objective_factory.ExternalBlackBox", "poli.objective_factory.create", "poli.objective_factory.load_config", "poli.objective_factory.start", "poli.objective_repository", "poli.objective_repository.albuterol_similarity", "poli.objective_repository.albuterol_similarity.information", "poli.objective_repository.albuterol_similarity.register", "poli.objective_repository.aloha", "poli.objective_repository.aloha.register", "poli.objective_repository.aloha.register.AlohaBlackBox", "poli.objective_repository.aloha.register.AlohaProblemFactory", "poli.objective_repository.amlodipine_mpo", "poli.objective_repository.amlodipine_mpo.information", "poli.objective_repository.amlodipine_mpo.register", "poli.objective_repository.celecoxib_rediscovery", "poli.objective_repository.celecoxib_rediscovery.information", "poli.objective_repository.celecoxib_rediscovery.register", "poli.objective_repository.deco_hop", "poli.objective_repository.deco_hop.information", "poli.objective_repository.deco_hop.register", "poli.objective_repository.dockstring", "poli.objective_repository.dockstring.information", "poli.objective_repository.dockstring.isolated_function", "poli.objective_repository.dockstring.register", "poli.objective_repository.dockstring.register.DockstringBlackBox", "poli.objective_repository.dockstring.register.DockstringProblemFactory", "poli.objective_repository.drd2_docking", "poli.objective_repository.drd2_docking.information", "poli.objective_repository.drd2_docking.register", "poli.objective_repository.drd3_docking", "poli.objective_repository.drd3_docking.information", "poli.objective_repository.drd3_docking.isolated_function", "poli.objective_repository.drd3_docking.register", "poli.objective_repository.drd3_docking.register.DRD3BlackBox", "poli.objective_repository.drd3_docking.register.DRD3ProblemFactory", "poli.objective_repository.ehrlich", "poli.objective_repository.ehrlich.information", "poli.objective_repository.ehrlich.register", "poli.objective_repository.fexofenadine_mpo", "poli.objective_repository.fexofenadine_mpo.information", "poli.objective_repository.fexofenadine_mpo.register", "poli.objective_repository.foldx_rfp_lambo", "poli.objective_repository.foldx_rfp_lambo.information", "poli.objective_repository.foldx_rfp_lambo.isolated_function", "poli.objective_repository.foldx_rfp_lambo.register", "poli.objective_repository.foldx_rfp_lambo.register.Config", "poli.objective_repository.foldx_rfp_lambo.register.RFPWrapper", "poli.objective_repository.foldx_rfp_lambo.register.RFPWrapperFactory", "poli.objective_repository.foldx_rfp_lambo.register.get_config", "poli.objective_repository.foldx_sasa", "poli.objective_repository.foldx_sasa.foldx_utils", "poli.objective_repository.foldx_sasa.information", "poli.objective_repository.foldx_sasa.isolated_function", "poli.objective_repository.foldx_sasa.register", "poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox", "poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory", "poli.objective_repository.foldx_stability", "poli.objective_repository.foldx_stability.foldx_utils", "poli.objective_repository.foldx_stability.information", "poli.objective_repository.foldx_stability.isolated_function", "poli.objective_repository.foldx_stability.register", "poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox", "poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory", "poli.objective_repository.foldx_stability_and_sasa", "poli.objective_repository.foldx_stability_and_sasa.information", "poli.objective_repository.foldx_stability_and_sasa.isolated_function", "poli.objective_repository.foldx_stability_and_sasa.register", "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox", "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory", "poli.objective_repository.gfp_cbas", "poli.objective_repository.gfp_cbas.abstract_vae_wrapper", "poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_aas_to_idx_array", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_idx_array_to_aas", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.convert_mutations_to_sequence", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_argmax", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_balaji_predictions", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_experimental_X_y", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_X_y_aa", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_gfp_base_seq", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.get_samples", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_aa_array", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.one_hot_encode_dna", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.partition_data", "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing.read_gfp_data", "poli.objective_repository.gfp_cbas.cbas_wrapper", "poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper", "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder", "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder", "poli.objective_repository.gfp_cbas.gfp_gp", "poli.objective_repository.gfp_cbas.information", "poli.objective_repository.gfp_cbas.isolated_function", "poli.objective_repository.gfp_cbas.make_vae", "poli.objective_repository.gfp_cbas.make_vae.BaseVAE", "poli.objective_repository.gfp_cbas.make_vae.SimpleVAE", "poli.objective_repository.gfp_cbas.make_vae.build_vae", "poli.objective_repository.gfp_cbas.make_vae.identity_loss", "poli.objective_repository.gfp_cbas.make_vae.summed_categorical_crossentropy", "poli.objective_repository.gfp_cbas.register", "poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox", "poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory", "poli.objective_repository.gfp_select", "poli.objective_repository.gfp_select.information", "poli.objective_repository.gfp_select.isolated_function", "poli.objective_repository.gfp_select.register", "poli.objective_repository.gfp_select.register.GFPBlackBox", "poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory", "poli.objective_repository.gsk3_beta", "poli.objective_repository.gsk3_beta.information", "poli.objective_repository.gsk3_beta.register", "poli.objective_repository.isomer_c7h8n2o2", "poli.objective_repository.isomer_c7h8n2o2.information", "poli.objective_repository.isomer_c7h8n2o2.register", "poli.objective_repository.isomer_c9h10n2o2pf2cl", "poli.objective_repository.isomer_c9h10n2o2pf2cl.information", "poli.objective_repository.isomer_c9h10n2o2pf2cl.register", "poli.objective_repository.jnk3", "poli.objective_repository.jnk3.information", "poli.objective_repository.jnk3.register", "poli.objective_repository.median_1", "poli.objective_repository.median_1.information", "poli.objective_repository.median_1.register", "poli.objective_repository.median_2", "poli.objective_repository.median_2.information", "poli.objective_repository.median_2.register", "poli.objective_repository.mestranol_similarity", "poli.objective_repository.mestranol_similarity.information", "poli.objective_repository.mestranol_similarity.register", "poli.objective_repository.osimetrinib_mpo", "poli.objective_repository.osimetrinib_mpo.information", "poli.objective_repository.osimetrinib_mpo.register", "poli.objective_repository.penalized_logp_lambo", "poli.objective_repository.penalized_logp_lambo.information", "poli.objective_repository.penalized_logp_lambo.isolated_function", "poli.objective_repository.penalized_logp_lambo.register", "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox", "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory", "poli.objective_repository.perindopril_mpo", "poli.objective_repository.perindopril_mpo.information", "poli.objective_repository.perindopril_mpo.register", "poli.objective_repository.ranolazine_mpo", "poli.objective_repository.ranolazine_mpo.information", "poli.objective_repository.ranolazine_mpo.register", "poli.objective_repository.rasp", "poli.objective_repository.rasp.information", "poli.objective_repository.rasp.isolated_function", "poli.objective_repository.rasp.register", "poli.objective_repository.rdkit_logp", "poli.objective_repository.rdkit_logp.information", "poli.objective_repository.rdkit_logp.register", "poli.objective_repository.rdkit_logp.register.LogPBlackBox", "poli.objective_repository.rdkit_logp.register.LogPProblemFactory", "poli.objective_repository.rdkit_qed", "poli.objective_repository.rdkit_qed.information", "poli.objective_repository.rdkit_qed.register", "poli.objective_repository.rdkit_qed.register.QEDBlackBox", "poli.objective_repository.rdkit_qed.register.QEDProblemFactory", "poli.objective_repository.rfp_foldx_stability_and_sasa", "poli.objective_repository.rfp_foldx_stability_and_sasa.information", "poli.objective_repository.rfp_foldx_stability_and_sasa.register", "poli.objective_repository.rmf_landscape", "poli.objective_repository.rmf_landscape.information", "poli.objective_repository.rmf_landscape.isolated_function", "poli.objective_repository.rmf_landscape.register", "poli.objective_repository.sa_tdc", "poli.objective_repository.sa_tdc.information", "poli.objective_repository.sa_tdc.isolated_function", "poli.objective_repository.sa_tdc.register", "poli.objective_repository.sa_tdc.register.SABlackBox", "poli.objective_repository.sa_tdc.register.SAProblemFactory", "poli.objective_repository.scaffold_hop", "poli.objective_repository.scaffold_hop.information", "poli.objective_repository.scaffold_hop.register", "poli.objective_repository.sitagliptin_mpo", "poli.objective_repository.sitagliptin_mpo.information", "poli.objective_repository.sitagliptin_mpo.register", "poli.objective_repository.super_mario_bros", "poli.objective_repository.super_mario_bros.information", "poli.objective_repository.super_mario_bros.level_utils", "poli.objective_repository.super_mario_bros.level_utils.add_padding_to_level", "poli.objective_repository.super_mario_bros.level_utils.clean_level", "poli.objective_repository.super_mario_bros.level_utils.level_to_array", "poli.objective_repository.super_mario_bros.level_utils.level_to_list", "poli.objective_repository.super_mario_bros.level_utils.levels_to_onehot", "poli.objective_repository.super_mario_bros.level_utils.onehot_to_levels", "poli.objective_repository.super_mario_bros.level_utils.tensor_to_sim_level", "poli.objective_repository.super_mario_bros.level_utils.vectorized", "poli.objective_repository.super_mario_bros.model", "poli.objective_repository.super_mario_bros.model.VAEMario", "poli.objective_repository.super_mario_bros.model.load_example_model", "poli.objective_repository.super_mario_bros.register", "poli.objective_repository.thiothixene_rediscovery", "poli.objective_repository.thiothixene_rediscovery.information", "poli.objective_repository.thiothixene_rediscovery.register", "poli.objective_repository.toy_continuous_problem", "poli.objective_repository.toy_continuous_problem.definitions", "poli.objective_repository.toy_continuous_problem.definitions.ackley_function_01", "poli.objective_repository.toy_continuous_problem.definitions.alpine_01", "poli.objective_repository.toy_continuous_problem.definitions.alpine_02", "poli.objective_repository.toy_continuous_problem.definitions.bent_cigar", "poli.objective_repository.toy_continuous_problem.definitions.brown", "poli.objective_repository.toy_continuous_problem.definitions.camelback_2d", "poli.objective_repository.toy_continuous_problem.definitions.chung_reynolds", "poli.objective_repository.toy_continuous_problem.definitions.cosine_mixture", "poli.objective_repository.toy_continuous_problem.definitions.cross_in_tray", "poli.objective_repository.toy_continuous_problem.definitions.deb_01", "poli.objective_repository.toy_continuous_problem.definitions.deb_02", "poli.objective_repository.toy_continuous_problem.definitions.deflected_corrugated_spring", "poli.objective_repository.toy_continuous_problem.definitions.easom", "poli.objective_repository.toy_continuous_problem.definitions.egg_holder", "poli.objective_repository.toy_continuous_problem.definitions.shifted_sphere", "poli.objective_repository.toy_continuous_problem.definitions.styblinski_tang", "poli.objective_repository.toy_continuous_problem.information", "poli.objective_repository.toy_continuous_problem.register", "poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox", "poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory", "poli.objective_repository.toy_continuous_problem.toy_continuous_problem", "poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem", "poli.objective_repository.troglitazone_rediscovery", "poli.objective_repository.troglitazone_rediscovery.information", "poli.objective_repository.troglitazone_rediscovery.register", "poli.objective_repository.valsartan_smarts", "poli.objective_repository.valsartan_smarts.information", "poli.objective_repository.valsartan_smarts.register", "poli.objective_repository.white_noise", "poli.objective_repository.white_noise.register", "poli.objective_repository.white_noise.register.WhiteNoiseBlackBox", "poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory", "poli.objective_repository.zaleplon_mpo", "poli.objective_repository.zaleplon_mpo.information", "poli.objective_repository.zaleplon_mpo.register", "poli.registered_objectives", "poli.tests", "poli.tests.benchmarks", "poli.tests.benchmarks.test_benchmark_creation", "poli.tests.conftest", "poli.tests.docs_examples", "poli.tests.docs_examples.test_objective_functions", "poli.tests.docs_examples.test_objective_functions.test_aloha_example", "poli.tests.docs_examples.test_objective_functions.test_logp_example", "poli.tests.docs_examples.test_objective_functions.test_logp_example_using_strings", "poli.tests.docs_examples.test_objective_functions.test_qed_example", "poli.tests.docs_examples.test_objective_functions.test_qed_example_using_strings", "poli.tests.docs_examples.test_objective_functions.test_white_noise_example", "poli.tests.information", "poli.tests.information.test_dynamic_information", "poli.tests.registry", "poli.tests.registry.basic_objectives", "poli.tests.registry.basic_objectives.test_basic_objectives", "poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_aloha", "poli.tests.registry.basic_objectives.test_basic_objectives.test_registering_white_noise", "poli.tests.registry.basic_objectives.test_budget_exhaustion", "poli.tests.registry.chemistry", "poli.tests.registry.chemistry.test_chemistry_objectives", "poli.tests.registry.proteins", "poli.tests.registry.proteins.test_foldx", "poli.tests.registry.proteins.test_foldx_rfp_lambo", "poli.tests.registry.proteins.test_rasp", "poli.tests.registry.test_basic_loop_without_create", "poli.tests.registry.test_black_box_instancing", "poli.tests.registry.test_force_isolation", "poli.tests.registry.test_instancing_black_boxes_alone", "poli.tests.registry.test_multi_objective_and_negative", "poli.tests.registry.test_passing_array_of_strings", "poli.tests.registry.toy_continuous_problems", "poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims", "poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims.test_embed_camelback_into_high_dimensions", "poli.tests.registry.toy_continuous_problems.test_instancing_of_toy_continuous_problems", "poli.tests.registry.toy_discrete_problems", "poli.tests.test_core_promises", "poli.tests.test_minimal_working_example", "poli.tests.test_minimal_working_example.test_minimal_working_example", "poli.tests.test_seeding", "poli.tests.test_seeding.test_seeding_in_white_noise", "poli.tests.util", "poli.tests.util.test_foldx_interface", "poli.tests.util.test_protein_utilities", "<no title>", "API documentation for poli", "References", "Adding a new black box to the repository", "Adding a new optimizer to poli-baselines", "Getting started", "poli \ud83e\uddea: a library of discrete objective functions", "Installing foldx", "Computing the energy of a protein and a single mutation", "Rapid Stability Predictions", "Albuterol Similarity (using TDC)", "All objective functions", "Aloha objective function", "Amlodipine MPO (using TDC)", "Celecoxib Rediscovery (using TDC)", "Deco Hop (using TDC)", "dockstring", "DRD2 Docking (using TDC)", "DRD3 docking (using TDC)", "Ehrlich functions", "Fexofenadine MPO (using TDC)", "Protein (RFP) stability and SASA (using foldx,lambo)", "Protein solvent accessibility (using foldx)", "Protein stability (using foldx)", "GSK3\u03b2 (using TDC)", "Isomer C7H8N2O2 (using TDC)", "Isomer C9H10N2O2PF2Cl (using TDC)", "c-Jun N-terminal Kinases-3 (using TDC)", "Median 1 (using TDC)", "Median 2 (using TDC)", "Mestranol Similarity (using TDC)", "Osimetrinib MPO (using TDC)", "Penalized logP (using lambo)", "Ranolazine MPO (using TDC)", "Log-solubility (logP)", "Quantitative Estimate of Druglikeness (QED)", "Synthetic Accessibility (using TDC)", "Scaffold Hop (using TDC)", "Sitagliptin MPO (using TDC)", "Optimizing jumps in Super Mario Bros", "Objective function name", "Thiothixene Rediscovery (using TDC)", "Toy continuous objective functions", "Troglitazone Rediscovery (using TDC)", "Valsartan SMARTS (using TDC)", "White Noise objective function", "Zaleplon MPO (using TDC)", "Registering and running observers in isolated processes", "Optimizing protein stability using random mutations", "Defining a problem solver in poli_baselines", "Defining an observer", "Diving deeper: how does poli work under the hood?", "What is poli?", "Isolating black box objective functions", "Adaptive Linear Embedding Bayesian Optimization (ALEBO)", "Adaptively expanding subspaces (BAxUS)", "Bayesian Optimization", "Bounce", "CMA-ES", "Graph Genetic Algorithms", "Hvarfner\u2019s Vanilla Bayesian Optimization", "LaMBO2", "Latent Space Bayesian Optimization", "Line Bayesian Optimization", "Discrete NSGA-2", "Probabilistic Reparametrization", "Random mutations", "Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)", "Template: optimization algorithm", "Trust Region Bayesian Optimization (Turbo)"], "terms": {"librari": [0, 39, 45, 306, 396, 438, 440, 441], "discret": [0, 21, 117, 118, 119, 146, 179, 390, 391, 392, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 442, 443, 444, 445, 448, 449, 451, 453, 455, 457], "black": [0, 3, 4, 5, 6, 11, 12, 13, 14, 19, 20, 21, 24, 25, 26, 46, 78, 109, 111, 112, 117, 118, 119, 132, 133, 142, 146, 152, 153, 158, 162, 163, 165, 169, 170, 172, 175, 176, 210, 220, 246, 256, 257, 260, 261, 265, 266, 268, 270, 279, 325, 336, 337, 371, 392, 395, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 437, 438, 440, 444, 449, 452], "box": [0, 3, 4, 5, 6, 11, 12, 13, 14, 19, 20, 21, 24, 25, 26, 46, 78, 109, 111, 112, 117, 118, 119, 132, 133, 142, 146, 152, 153, 158, 162, 163, 165, 169, 170, 172, 175, 176, 210, 220, 246, 256, 257, 260, 261, 265, 266, 268, 270, 279, 325, 336, 337, 371, 392, 395, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 437, 438, 440, 444, 449, 452], "object": [0, 3, 4, 5, 6, 14, 19, 20, 25, 26, 39, 55, 59, 64, 65, 74, 81, 88, 89, 107, 109, 110, 111, 112, 116, 117, 118, 129, 132, 133, 138, 142, 152, 153, 162, 163, 165, 169, 170, 175, 176, 210, 220, 229, 246, 260, 265, 267, 270, 277, 278, 279, 301, 306, 322, 324, 325, 328, 336, 369, 371, 376, 390, 391, 392, 393, 397, 398, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 431, 432, 434, 437, 438, 442, 443, 444, 445, 448, 449, 451, 452, 453, 455, 457], "function": [0, 3, 4, 5, 6, 14, 15, 19, 20, 21, 28, 39, 42, 43, 44, 45, 47, 51, 52, 57, 58, 60, 62, 63, 65, 69, 73, 76, 77, 82, 85, 86, 100, 107, 109, 111, 112, 116, 117, 118, 129, 132, 133, 138, 142, 146, 152, 153, 158, 163, 165, 170, 176, 181, 203, 210, 244, 245, 246, 260, 261, 265, 266, 267, 279, 289, 301, 305, 306, 322, 324, 325, 327, 328, 336, 337, 346, 356, 359, 369, 371, 373, 376, 380, 383, 390, 391, 392, 393, 396, 397, 398, 401, 402, 403, 404, 405, 406, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434, 437, 438, 444, 451, 452], "modul": [0, 1, 3, 6, 7, 12, 24, 25, 28, 37, 41, 43, 44, 46, 56, 57, 60, 62, 63, 66, 72, 73, 78, 79, 80, 82, 86, 93, 99, 112, 113, 116, 120, 123, 126, 129, 132, 135, 138, 144, 146, 147, 150, 158, 165, 172, 178, 198, 200, 212, 218, 221, 224, 227, 230, 233, 236, 239, 242, 244, 245, 248, 251, 254, 256, 257, 258, 263, 268, 271, 275, 281, 284, 287, 302, 305, 329, 332, 335, 339, 343, 344, 355, 357, 358, 363, 365, 369, 371, 375, 379, 383, 385, 388], "class": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 18, 19, 20, 21, 25, 26, 27, 38, 39, 40, 53, 54, 55, 63, 64, 68, 70, 80, 81, 115, 117, 118, 119, 122, 125, 128, 131, 132, 133, 134, 137, 141, 142, 143, 146, 149, 152, 153, 161, 162, 163, 164, 168, 169, 170, 171, 174, 175, 176, 177, 179, 180, 196, 197, 198, 199, 200, 202, 203, 204, 205, 209, 210, 211, 214, 215, 217, 220, 223, 226, 229, 232, 235, 238, 241, 244, 245, 246, 247, 250, 253, 256, 257, 260, 261, 262, 265, 266, 267, 270, 273, 274, 277, 278, 279, 280, 283, 286, 301, 304, 324, 325, 326, 327, 328, 331, 334, 336, 337, 338, 341, 391, 392, 407, 437, 438, 449], "util": [1, 28, 200, 289, 391, 438, 441, 442, 444, 448, 455], "insid": [1, 6, 16, 112, 138, 391, 393, 394, 396, 397, 406, 427, 430, 436, 440, 441, 449], "thi": [3, 5, 6, 7, 8, 11, 15, 19, 20, 21, 25, 28, 39, 44, 45, 51, 52, 57, 58, 60, 64, 65, 73, 77, 79, 80, 81, 82, 85, 86, 109, 111, 115, 117, 122, 125, 128, 132, 137, 138, 143, 146, 149, 162, 169, 175, 196, 200, 220, 223, 226, 229, 232, 235, 238, 241, 244, 245, 250, 253, 256, 257, 260, 265, 270, 283, 286, 304, 306, 322, 324, 325, 331, 334, 336, 341, 369, 371, 376, 380, 383, 391, 392, 393, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "implement": [3, 5, 6, 7, 11, 12, 13, 15, 19, 20, 21, 24, 25, 44, 80, 115, 118, 122, 125, 128, 132, 133, 137, 141, 146, 149, 163, 170, 176, 179, 196, 204, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 256, 257, 274, 277, 278, 279, 283, 286, 304, 325, 331, 334, 341, 391, 392, 394, 399, 404, 407, 409, 415, 420, 430, 436, 437, 440, 441, 442, 443, 444, 445, 446, 448, 449, 452, 453, 455, 457], "abstract": [3, 4, 6, 7, 8, 13, 14, 21, 38, 39, 390, 391, 436, 442, 457], "from": [3, 26, 45, 51, 52, 56, 57, 58, 59, 60, 61, 80, 81, 85, 93, 111, 115, 122, 125, 128, 138, 149, 163, 170, 176, 182, 187, 190, 205, 223, 226, 232, 235, 238, 241, 250, 253, 256, 257, 283, 286, 292, 295, 304, 306, 312, 321, 331, 334, 341, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "which": [3, 4, 6, 9, 14, 21, 26, 54, 61, 81, 85, 89, 110, 132, 142, 246, 265, 267, 279, 324, 325, 337, 391, 392, 396, 397, 399, 406, 407, 409, 424, 427, 430, 436, 437, 438, 440, 441, 444, 448, 455], "all": [3, 13, 107, 109, 112, 117, 118, 119, 138, 196, 306, 337, 391, 392, 393, 396, 397, 400, 407, 436, 437, 440, 441], "should": [3, 64, 138, 146, 391, 393, 395, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 430, 431, 432, 433, 434, 436, 437, 438, 441], "inherit": [3, 20, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 392, 436, 437, 438], "info": [26, 142, 337, 392, 436, 437, 438, 440, 445, 449, 452, 453], "problemsetupinform": [26, 39, 337, 409, 438], "batch_siz": [4, 5, 14, 20, 26, 109, 118, 133, 142, 163, 170, 176, 192, 210, 246, 261, 266, 279, 325, 337, 391, 407, 452], "option": [4, 5, 14, 20, 26, 48, 50, 51, 52, 55, 58, 61, 74, 81, 83, 84, 87, 88, 89, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 328, 337, 392, 407, 449], "int": [4, 5, 14, 20, 26, 39, 45, 65, 77, 83, 84, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 197, 210, 246, 261, 266, 279, 290, 291, 294, 325, 328, 337, 391, 392, 407, 437, 438, 440, 445, 449, 453], "none": [4, 5, 14, 20, 26, 39, 51, 52, 55, 58, 74, 81, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 191, 193, 195, 210, 211, 246, 261, 266, 279, 325, 328, 337, 391, 392, 398, 400, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 438, 449], "parallel": [4, 5, 14, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 407], "bool": [4, 5, 14, 26, 48, 49, 50, 51, 52, 58, 81, 83, 84, 87, 88, 89, 109, 111, 118, 133, 142, 163, 170, 176, 188, 210, 246, 261, 266, 279, 322, 325, 337, 391, 407], "fals": [4, 5, 14, 26, 49, 50, 51, 52, 58, 81, 84, 87, 88, 89, 109, 111, 118, 133, 142, 163, 170, 176, 187, 188, 194, 210, 246, 261, 266, 279, 295, 325, 337, 391, 397, 407, 427, 433, 438, 440], "num_work": [4, 5, 14, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 407], "evaluation_budget": [4, 5, 14, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 407], "inf": [4, 5, 13, 14, 26, 109, 115, 118, 122, 125, 128, 133, 142, 149, 163, 170, 176, 210, 223, 226, 232, 235, 238, 241, 246, 250, 253, 261, 266, 279, 283, 286, 304, 325, 331, 334, 337, 341, 391, 407, 433, 440], "base": [4, 8, 18, 39, 64, 138, 204, 390, 393, 394, 396, 399, 424, 442, 443, 445, 448, 449, 452, 453, 455, 457], "optim": [4, 6, 13, 21, 39, 80, 125, 146, 150, 242, 244, 245, 304, 305, 306, 324, 327, 331, 376, 390, 395, 396, 399, 402, 405, 407, 409, 410, 411, 412, 413, 414, 415, 416, 417, 420, 429, 430, 431, 437, 438, 443, 445, 449, 452, 453, 454], "problem": [4, 7, 8, 11, 13, 14, 26, 28, 42, 72, 73, 109, 117, 118, 119, 133, 134, 143, 164, 177, 260, 265, 267, 268, 280, 287, 306, 324, 325, 335, 336, 337, 376, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 431, 432, 433, 434, 438, 440, 441, 443, 445, 449, 452, 453, 454], "paramet": [4, 5, 8, 14, 20, 26, 45, 48, 49, 50, 51, 52, 55, 58, 59, 61, 64, 65, 74, 77, 81, 82, 83, 84, 85, 87, 88, 89, 101, 102, 109, 111, 118, 119, 133, 134, 142, 163, 164, 170, 176, 177, 210, 246, 261, 266, 267, 279, 280, 325, 337, 392, 407, 449], "The": [4, 5, 11, 14, 20, 21, 25, 26, 39, 45, 55, 58, 59, 61, 64, 65, 74, 77, 80, 81, 83, 84, 85, 87, 88, 89, 109, 110, 111, 116, 117, 118, 119, 133, 138, 142, 162, 163, 169, 170, 175, 176, 204, 210, 242, 246, 261, 266, 267, 270, 271, 274, 279, 301, 320, 321, 324, 325, 336, 337, 390, 392, 394, 396, 397, 399, 404, 405, 407, 409, 410, 411, 412, 427, 436, 437, 441, 442, 443, 448, 449, 452, 455, 457], "setup": [21, 26, 55, 77, 143, 337, 409], "inform": [4, 11, 21, 26, 39, 55, 77, 109, 111, 132, 133, 134, 143, 256, 257, 328, 337, 390, 396, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 436, 438, 440, 442, 443, 449, 453, 457], "provid": [20, 55, 107, 115, 143, 170, 238, 391, 394, 395, 396, 405, 407, 427, 438, 440, 441, 442, 445, 449, 453], "detail": [82, 146, 396, 407, 436, 440], "about": [109, 111, 391, 394, 395, 399, 436, 440], "batch": [4, 5, 14, 20, 26, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 407], "size": [4, 5, 14, 20, 26, 45, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 407, 443, 446, 449, 452], "evalu": [4, 5, 6, 14, 19, 20, 21, 26, 109, 111, 118, 133, 142, 146, 163, 170, 176, 210, 246, 261, 266, 267, 279, 325, 337, 392, 393, 407, 410, 411, 437, 438, 441, 449], "default": [4, 5, 14, 20, 26, 53, 55, 58, 61, 81, 83, 84, 87, 88, 89, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 392, 398, 401, 402, 403, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 444, 449, 451], "flag": [4, 5, 14, 26, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325], "indic": [4, 5, 14, 26, 118, 133, 142, 163, 170, 176, 182, 183, 210, 246, 261, 266, 279, 325, 392, 437], "whether": [4, 5, 11, 14, 21, 26, 58, 87, 88, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 371, 383, 391, 396, 397, 407, 422, 423, 427, 436, 438], "number": [4, 5, 14, 21, 26, 45, 65, 77, 99, 100, 101, 102, 109, 111, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 301, 325, 337, 392, 398, 399, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 437, 440, 448, 449], "worker": [4, 5, 14, 26, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337], "us": [4, 5, 6, 9, 11, 14, 21, 26, 39, 40, 51, 52, 55, 58, 60, 64, 65, 79, 80, 81, 109, 111, 115, 117, 118, 122, 125, 128, 133, 137, 138, 141, 142, 149, 163, 169, 170, 172, 176, 186, 187, 188, 210, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 246, 250, 253, 256, 257, 258, 261, 263, 265, 266, 268, 271, 277, 278, 279, 283, 286, 304, 324, 325, 331, 334, 336, 341, 369, 376, 390, 391, 392, 395, 396, 397, 399, 400, 404, 407, 422, 423, 427, 430, 433, 435, 437, 438, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 455, 457], "half": [4, 5, 14, 109, 142, 163, 170, 176, 210, 246, 325, 337], "avail": [4, 5, 14, 109, 138, 142, 162, 163, 169, 170, 175, 176, 210, 246, 270, 325, 337, 391, 393, 396, 399, 409, 410, 411, 422, 423, 427, 430, 436, 440, 449], "cpu": [4, 5, 14, 109, 142, 163, 170, 176, 210, 246, 325, 337], "maximum": [4, 5, 14, 21, 109, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 391, 392, 449], "allow": [4, 5, 6, 9, 11, 14, 21, 25, 26, 109, 142, 162, 163, 169, 170, 175, 176, 210, 246, 260, 265, 270, 324, 325, 391, 392, 395, 396, 427, 430, 437, 440], "float": [4, 5, 14, 26, 142, 163, 170, 176, 210, 246, 261, 265, 266, 279, 318, 325, 337, 391, 394, 407], "type": [4, 14, 20, 26, 48, 49, 50, 51, 52, 59, 64, 65, 74, 81, 83, 84, 85, 87, 88, 89, 109, 110, 118, 133, 137, 142, 184, 189, 261, 266, 271, 274, 325, 391, 396, 405, 449], "observ": [4, 6, 28, 37, 38, 39, 40, 53, 54, 55, 72, 73, 74, 76, 77, 109, 111, 187, 392, 394], "record": [4, 301], "dure": [4, 77, 391, 430], "abstractobserv": [4, 74, 438], "observer_info": 4, "given": [4, 20, 51, 52, 65, 74, 81, 84, 89, 132, 133, 134, 170, 184, 185, 186, 301, 392, 393, 397, 398, 401, 404, 407, 408, 413, 414, 418, 419, 421, 426, 427, 434, 437], "after": [4, 39, 138, 391, 392, 396, 406, 409, 436, 437, 449], "initi": [4, 5, 14, 20, 21, 26, 39, 55, 64, 77, 81, 109, 111, 118, 133, 142, 163, 170, 176, 210, 246, 261, 266, 279, 325, 337, 392, 396, 407, 436, 437, 440, 449, 452], "set_observ": [4, 435, 438], "set": [4, 39, 64, 89, 138, 186, 188, 194, 200, 261, 266, 391, 392, 404, 407, 424, 427, 437, 438, 440, 449], "reset_evaluation_budget": 4, "reset": [4, 111], "budget": [4, 17, 21, 26, 111, 407, 440], "made": 4, "0": [4, 81, 83, 163, 170, 176, 206, 265, 271, 274, 295, 318, 392, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 437, 438, 440, 442, 443, 444, 445, 446, 448, 449, 451, 453, 455, 457], "__call__": [4, 5, 6, 391], "x": [4, 5, 6, 20, 39, 55, 111, 118, 133, 137, 138, 170, 188, 193, 194, 261, 266, 307, 308, 309, 310, 311, 312, 313, 314, 316, 317, 318, 321, 322, 325, 337, 390, 391, 392, 393, 398, 400, 401, 402, 403, 404, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 444, 453], "context": [4, 6, 20, 39, 55, 111, 118, 133, 170, 261, 266, 325, 337, 391, 438], "input": [4, 20, 42, 44, 109, 118, 133, 170, 261, 266, 274, 325, 337, 391, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 437, 442, 443, 444, 448, 451, 452, 453, 455, 457], "_black_box": [4, 5, 6, 20, 118, 133, 170, 261, 266, 325, 337, 391], "method": [4, 5, 6, 8, 9, 14, 20, 26, 39, 55, 64, 81, 85, 89, 109, 118, 119, 133, 134, 142, 143, 163, 164, 170, 171, 176, 177, 180, 186, 197, 198, 199, 204, 205, 210, 211, 217, 246, 247, 261, 262, 266, 267, 279, 280, 325, 326, 328, 337, 338, 391, 392, 396, 409, 410, 411, 436, 437, 438, 440], "termin": [4, 77, 438], "__enter__": 4, "enter": 4, "manag": [4, 58, 111], "__exit__": 4, "exc_typ": 4, "exc_val": 4, "exc_tb": 4, "exit": 4, "__del__": 4, "destructor": 4, "__neg__": 4, "creat": [4, 8, 21, 26, 58, 64, 72, 73, 74, 107, 111, 119, 134, 143, 164, 177, 267, 280, 287, 369, 371, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 431, 432, 433, 434, 436, 438, 441, 442, 443, 445, 448, 449, 452, 453, 454, 455, 456], "new": [4, 14, 142, 394, 396, 437, 440, 449], "neg": [4, 208, 397, 404, 411], "origin": [4, 5, 81, 82, 85, 179, 321, 396, 442, 443, 448, 453, 455, 457], "one": [4, 191, 294, 390, 391, 392, 394, 396, 397, 399, 409, 436, 437, 441, 451], "__init__": [4, 5, 8, 9, 14, 20, 26, 39, 55, 64, 81, 118, 119, 133, 134, 142, 143, 163, 164, 170, 171, 176, 177, 180, 197, 198, 199, 204, 205, 210, 211, 217, 246, 247, 261, 262, 266, 267, 279, 280, 325, 326, 328, 337, 338, 392, 437, 438], "execut": [4, 5, 14, 60, 64, 74, 138, 142, 163, 170, 176, 210, 246, 279, 325, 395, 406], "we": [4, 5, 14, 19, 26, 79, 85, 109, 115, 122, 125, 128, 137, 138, 142, 149, 162, 163, 169, 170, 175, 176, 187, 210, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 246, 250, 253, 260, 261, 265, 266, 270, 283, 286, 304, 306, 320, 322, 324, 325, 331, 334, 341, 376, 380, 391, 392, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 455, 457], "f": [5, 25, 79, 80, 111, 162, 169, 175, 270, 391, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 441, 444, 446, 449, 451, 452, 454, 456], "abstractblackbox": [5, 14, 20, 111, 142, 163, 170, 176, 210, 246, 325, 391, 392, 437, 438, 449], "A": [5, 13, 14, 26, 40, 45, 48, 49, 50, 51, 52, 79, 81, 83, 84, 85, 87, 88, 111, 117, 118, 119, 138, 142, 146, 150, 158, 162, 163, 169, 170, 172, 175, 176, 246, 261, 266, 268, 270, 275, 279, 287, 305, 325, 327, 335, 337, 390, 393, 394, 396, 397, 399, 400, 405, 407, 410, 411, 412, 415, 424, 427, 430, 438, 442, 449, 451, 453], "wrapper": [5, 15, 40, 138, 150, 179, 196, 260, 265, 275, 394, 399, 452], "negat": [5, 210], "If": [5, 20, 39, 45, 48, 49, 50, 51, 52, 55, 58, 59, 65, 77, 80, 81, 83, 84, 85, 89, 101, 102, 109, 111, 220, 322, 325, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 438, 440, 441, 442, 443, 445, 448, 449, 451, 453, 455, 457], "you": [5, 6, 14, 81, 89, 115, 122, 125, 128, 137, 138, 142, 149, 220, 223, 226, 229, 232, 241, 250, 253, 261, 266, 279, 283, 286, 304, 306, 331, 334, 341, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 445, 448, 449, 451, 453, 455, 457], "construct": [5, 205, 407], "maxim": [5, 128, 146, 301, 306, 321, 322, 392, 397, 407, 430], "minim": [5, 306, 391, 392, 399, 404, 437, 449, 452], "latter": [5, 396], "onli": [5, 6, 111, 179, 187, 196, 315, 319, 320, 325, 392, 393, 396, 397, 404, 409, 410, 411, 430, 437], "differ": [5, 25, 83, 162, 169, 175, 270, 391, 392, 393, 396, 397, 437, 438, 441, 442, 443, 445, 448, 449, 453, 455], "return": [5, 26, 48, 49, 50, 51, 52, 59, 61, 65, 74, 81, 83, 84, 85, 87, 88, 89, 109, 110, 111, 170, 184, 185, 186, 189, 191, 206, 207, 246, 260, 261, 265, 266, 267, 293, 335, 336, 337, 391, 392, 397, 400, 404, 407, 409, 410, 411, 422, 423, 427, 433, 436, 437, 449], "instead": [5, 306, 392, 410, 411, 437, 448], "same": [5, 84, 85, 242, 244, 245, 246, 391, 393, 397, 416, 417], "factori": [7, 8, 25, 64, 107, 109, 111, 112, 116, 117, 119, 129, 132, 134, 143, 152, 153, 162, 164, 165, 169, 175, 177, 260, 265, 267, 270, 280, 301, 324, 336, 391, 394, 407], "defin": [8, 82, 268, 306, 376, 392, 430, 440, 441, 445, 453], "interfac": [8, 80, 107, 391, 394, 412, 415, 432, 441, 445, 448, 453], "instanc": [8, 14, 20, 119, 134, 142, 164, 177, 267, 280, 325, 391, 392, 393, 436, 441, 452], "get_setup_inform": 391, "specifi": [8, 14, 58, 59, 109, 119, 134, 142, 164, 177, 185, 190, 198, 204, 267, 279, 280, 324, 396, 422, 423, 442, 449, 452], "metaclass": 9, "abstractproblemfactori": [9, 391], "overrid": [9, 449], "__repr__": 9, "__str__": 9, "arg": [9, 198, 199, 204, 205, 391, 396], "kwarg": [9, 198, 199, 204, 205, 391, 449], "contain": [6, 11, 12, 24, 28, 45, 60, 73, 79, 82, 83, 84, 86, 110, 182, 183, 200, 328, 380, 391, 393, 396, 407, 410, 411, 427], "relat": [12, 13, 24, 46, 78, 109, 395, 436, 449], "around": [15, 40, 138, 150, 260, 265, 275, 394, 399, 452], "therapeut": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 394, 398, 399, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "data": [14, 15, 43, 58, 118, 133, 138, 187, 188, 194, 195, 200, 220, 229, 390, 394, 396, 398, 399, 401, 402, 403, 405, 406, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "common": [14, 15, 107, 390, 394, 396, 398, 399, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 452], "tdc": [13, 14, 15, 115, 122, 125, 128, 137, 138, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 275, 277, 278, 279, 283, 286, 304, 331, 334, 341, 394, 399], "oracl": [14, 15, 115, 122, 125, 128, 137, 141, 142, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 275, 277, 278, 279, 283, 286, 304, 331, 334, 341, 394, 398, 399, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "1": [13, 14, 15, 25, 45, 80, 83, 85, 111, 115, 122, 125, 128, 132, 133, 134, 137, 141, 146, 149, 150, 162, 163, 169, 170, 175, 176, 182, 183, 187, 194, 206, 210, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 246, 250, 253, 256, 257, 265, 270, 271, 274, 277, 278, 279, 283, 286, 290, 304, 306, 312, 321, 324, 328, 331, 334, 341, 390, 392, 393, 394, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 437, 438, 440, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 455, 457], "so": [85, 261, 266, 391, 392, 396, 409, 420, 437, 441], "far": [392, 437], "support": [369, 393, 437, 441], "two": [65, 83, 393, 396, 430, 438, 441, 452], "drd3": [138, 141, 142, 143, 394, 399], "synthet": [275, 277, 278, 279, 280, 390, 394, 399], "access": [58, 81, 138, 158, 163, 164, 172, 176, 177, 268, 277, 278, 279, 280, 390, 391, 394, 396, 399, 406, 422, 423, 427, 430], "see": [51, 52, 82, 117, 138, 271, 306, 324, 327, 336, 392, 393, 396, 397, 409, 436, 440, 441], "document": [393, 394, 396, 413, 414, 426, 434, 436, 441], "our": [391, 392, 396, 397, 399, 404, 410, 411, 436, 437, 438, 440, 441, 444, 446, 448, 449, 452], "more": [82, 163, 170, 176, 327, 328, 393, 396, 413, 414, 426, 434, 436, 440], "refer": [13, 14, 15, 25, 80, 115, 122, 125, 128, 132, 133, 134, 137, 138, 141, 146, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 274, 277, 278, 283, 286, 304, 331, 334, 341, 394, 397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434], "artifici": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 306, 331, 334, 341, 390, 427, 455], "intellig": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 455], "foundat": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "scienc": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 397], "huang": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "kexin": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "tianfan": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "fu": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "wenhao": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "gao": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 398, 399, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "yue": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "zhao": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "yusuf": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "roohani": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "jure": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "leskovec": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "connor": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "w": [13, 14, 15, 79, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 277, 278, 283, 286, 294, 304, 331, 334, 341, 390, 394, 396, 398, 401, 402, 403, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 438], "colei": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "cao": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "xiao": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "jimeng": [13, 15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "sun": [13, 15, 220, 229, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "marinka": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "zitnik": [15, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "natur": 15, "chemic": [15, 132, 133, 134, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "biologi": [15, 138, 162, 169, 175, 270, 390, 406], "18": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390], "10": [13, 14, 15, 45, 115, 122, 125, 128, 132, 133, 134, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 392, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 433, 434, 436, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 455, 457], "octob": 15, "2022": [13, 14, 15, 80, 115, 122, 125, 128, 132, 133, 134, 137, 141, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341, 390, 395, 396, 399, 404, 405, 409, 410, 411, 412, 415, 420, 436, 443, 453], "1033": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "36": [15, 449], "http": [13, 14, 15, 45, 57, 58, 80, 82, 115, 122, 125, 128, 132, 133, 134, 137, 138, 141, 146, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 306, 327, 328, 331, 334, 341, 390, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 440, 442, 443, 445, 448, 449, 451, 453, 455, 457], "doi": [13, 14, 15, 115, 122, 125, 128, 132, 133, 134, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 448], "org": [13, 14, 15, 45, 80, 115, 122, 125, 128, 132, 133, 134, 137, 141, 146, 149, 150, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 256, 257, 271, 274, 277, 278, 283, 286, 304, 306, 327, 328, 331, 334, 341, 390, 396, 397, 398, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 430, 431, 432, 434, 445, 448], "1038": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "s41589": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "022": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "01131": [13, 14, 15, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "2": [13, 14, 15, 45, 80, 83, 115, 122, 125, 128, 137, 141, 149, 162, 169, 175, 182, 183, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 270, 271, 274, 277, 278, 283, 286, 304, 306, 322, 325, 328, 331, 334, 341, 390, 391, 393, 394, 396, 397, 398, 399, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 440, 442, 443, 444, 445, 448, 449, 451, 453, 455, 457], "oracle_nam": [14, 142], "str": [14, 26, 48, 49, 50, 51, 52, 55, 58, 59, 61, 64, 65, 74, 77, 81, 83, 84, 85, 87, 88, 89, 109, 111, 133, 142, 163, 170, 176, 211, 292, 293, 325, 391, 396, 407, 433, 438, 445, 449, 453], "from_smil": [142, 261, 266], "true": [48, 49, 50, 51, 52, 58, 81, 83, 84, 89, 109, 111, 142, 188, 205, 210, 246, 261, 266, 322, 391, 396, 410, 411, 433, 436, 438, 440], "kwargs_for_oracl": 14, "repres": [26, 65, 83, 88, 142, 204, 440], "It": [64, 65, 138, 391, 392, 393, 396, 404, 406, 437, 440, 442], "name": [11, 14, 15, 55, 58, 59, 77, 87, 88, 89, 109, 111, 133, 142, 325, 328, 391, 392, 393, 396, 397, 409, 433, 436, 438, 440, 443, 445, 449, 453], "comput": [25, 61, 81, 83, 85, 118, 133, 138, 162, 163, 169, 170, 172, 175, 176, 242, 244, 245, 258, 261, 266, 268, 270, 306, 390, 393, 394, 395, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 441, 442, 443, 445, 448, 449, 451, 453, 455, 457], "dock": [132, 133, 134, 137, 138, 141, 142, 143, 390, 394, 399, 404, 441], "score": [132, 133, 134, 163, 170, 176, 390, 394, 397, 399, 404, 405, 406, 410, 411, 420, 424, 441], "an": [6, 13, 14, 15, 21, 25, 39, 42, 45, 48, 49, 50, 51, 52, 54, 55, 58, 65, 76, 77, 80, 85, 109, 111, 162, 169, 175, 182, 183, 220, 229, 270, 294, 325, 391, 393, 394, 395, 396, 397, 404, 407, 409, 410, 411, 412, 415, 427, 428, 430, 432, 436, 440, 441, 442, 443, 444, 445, 446, 448, 449, 452, 453, 455, 457], "process": [6, 39, 54, 55, 64, 65, 76, 77, 109, 111, 118, 133, 163, 169, 170, 176, 200, 261, 266, 390, 391, 396, 398, 401, 402, 403, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 440, 441, 442, 443, 444, 449, 453, 455, 457], "multipl": [118, 133, 261, 266, 397], "infin": [14, 109, 118, 133, 142, 163, 170, 176, 261, 266, 279], "molecul": [14, 47, 48, 49, 50, 115, 132, 133, 134, 137, 142, 220, 229, 238, 246, 261, 266, 267, 279, 304, 331, 390, 393, 396, 404, 405, 406, 412, 415, 416, 417, 424, 440], "ar": [6, 21, 39, 80, 83, 85, 110, 138, 146, 188, 246, 261, 266, 267, 324, 376, 391, 392, 393, 395, 397, 399, 407, 409, 410, 411, 422, 423, 427, 428, 430, 436, 437, 438, 440, 441, 444, 448, 449], "smile": [14, 49, 50, 51, 52, 115, 128, 133, 142, 238, 246, 260, 261, 265, 266, 279, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 429, 431, 432, 434], "format": [64, 82, 85, 184], "represent": [14, 47, 50, 133, 142, 256, 257, 261, 266, 279, 390, 397, 441], "dict": [14, 64, 109, 111, 118, 133, 391, 449], "addit": [55, 64, 74, 109, 111, 146, 397, 407], "keyword": [14, 55, 64, 109, 111, 391, 410, 411], "argument": [14, 39, 55, 64, 109, 111, 410, 411], "custom": 16, "packag": [16, 18, 51, 52, 57, 436, 440, 441, 443], "rais": [17, 20, 48, 49, 51, 52, 58, 59, 65, 80, 83, 84, 392, 395, 437], "when": [15, 17, 64, 109, 111, 115, 122, 125, 128, 137, 146, 149, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 391, 397, 407, 413, 414, 426, 434, 438, 440, 441], "exhaust": 17, "multi_object": 19, "version": [19, 55, 81, 138, 242, 265, 267, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 437, 438, 442, 443, 445, 448, 449, 451, 452, 453, 455, 457], "mean": [19, 85, 186, 246, 391, 392, 420, 430, 446], "simpli": [19, 392, 393, 409, 437, 438], "concaten": [19, 20, 261, 266], "result": [19, 20, 81, 261, 266, 396, 438, 441], "individu": [19, 20, 82, 293, 396, 438, 441], "objective_funct": [20, 452], "list": [20, 26, 48, 49, 50, 51, 52, 74, 81, 82, 83, 84, 85, 87, 88, 163, 170, 176, 182, 196, 205, 291, 293, 325, 328, 391, 394, 396, 407, 410, 411, 438, 440, 445, 449, 453], "multi": [20, 220, 229, 390, 401, 408, 412, 415, 419, 421, 426, 434, 452], "requir": [20, 26, 39, 57, 58, 138, 391, 392, 394, 396, 397, 427, 436, 437, 438, 440, 441], "valueerror": [20, 59, 84], "e": [6, 21, 58, 79, 85, 111, 118, 138, 146, 182, 183, 187, 256, 257, 261, 266, 267, 322, 337, 390, 391, 392, 393, 394, 396, 397, 399, 404, 407, 409, 410, 411, 433, 436, 437, 438, 442, 448, 453, 455], "g": [6, 21, 79, 85, 182, 183, 267, 274, 390, 391, 392, 393, 394, 396, 399, 407, 410, 411, 433, 436, 437, 438, 449, 455], "alphabet": [11, 26, 118, 133, 391, 392, 407, 409, 433, 436, 437, 438, 440, 445, 449, 452, 453, 454, 456], "sequenc": [11, 80, 117, 118, 119, 146, 150, 182, 183, 184, 185, 189, 190, 191, 242, 244, 245, 390, 391, 392, 394, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 440, 442, 443, 445, 448, 449, 451, 453, 455, 457], "length": [11, 45, 83, 84, 193, 391, 396, 407, 445, 453], "max_sequence_length": [391, 433, 438, 440], "align": [11, 390, 391, 394, 433, 438, 440], "log_transform_recommend": [391, 433, 438], "s": [11, 21, 26, 51, 52, 79, 80, 111, 138, 146, 163, 170, 176, 179, 256, 257, 260, 261, 265, 266, 267, 306, 320, 390, 393, 394, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 445, 449, 451, 452, 453, 455, 457], "longest": 11, "have": [6, 11, 45, 138, 146, 163, 170, 176, 306, 369, 391, 392, 393, 395, 396, 397, 404, 406, 407, 409, 410, 411, 420, 427, 428, 436, 437, 440, 441, 442, 443, 445, 448, 449, 453, 455], "been": [306, 395], "charact": 11, "mai": [256, 257, 390, 397, 440, 443, 445, 451, 453], "appear": [393, 396], "recommend": [115, 122, 125, 128, 137, 138, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 391, 393, 394, 406, 409, 427, 446, 449], "algorithm": [21, 39, 146, 324, 376, 390, 392, 396, 407, 430, 437, 438, 440, 444, 452], "log": [55, 208, 242, 258, 260, 261, 391, 392, 394, 399, 448], "transform": [47, 289, 294, 295, 391], "target": [118, 133], "foldx": [25, 26, 82, 85, 162, 163, 164, 165, 169, 170, 172, 175, 176, 177, 256, 257, 268, 270, 393, 394, 396, 399, 436, 441], "simul": [25, 26, 80, 81, 162, 169, 175, 270, 306, 391, 393, 427], "free": [25, 162, 169, 175, 270, 391, 392, 395, 396], "energi": [25, 81, 162, 169, 175, 270, 395, 411], "between": [25, 83, 85, 118, 162, 169, 175, 265, 270, 407, 413, 414, 422, 426, 434], "wildtyp": [25, 26, 84, 85, 162, 163, 169, 170, 175, 176, 256, 257, 270, 394, 397, 399, 410, 411], "mutat": [25, 26, 81, 162, 169, 175, 184, 270, 390, 392, 394, 397, 399, 410, 411, 437, 440, 452], "web": [25, 80, 162, 169, 175, 270, 409, 410, 411], "server": [25, 64, 65, 80, 162, 169, 175, 270, 409, 410, 411], "onlin": [25, 80, 162, 169, 175, 270, 409, 410, 411], "forc": [14, 25, 80, 142, 162, 169, 175, 270, 371, 409, 410, 411], "field": [25, 80, 162, 169, 175, 270, 409, 410, 411], "nucleic": [25, 80, 162, 169, 175, 270, 409, 410, 411], "acid": [25, 26, 79, 80, 162, 169, 175, 182, 183, 185, 190, 191, 270, 407, 409, 410, 411], "research": [25, 80, 162, 169, 175, 270, 390, 409, 410, 411], "schymkowitz": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "j": [13, 25, 80, 115, 122, 125, 128, 132, 133, 134, 149, 162, 169, 175, 223, 226, 232, 235, 238, 241, 250, 253, 270, 271, 274, 283, 286, 304, 331, 334, 341, 390, 404, 427, 438, 449, 451, 457], "borg": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "stricher": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "ny": [25, 80, 162, 169, 175, 270, 409, 410, 411], "r": [25, 79, 80, 85, 146, 162, 169, 175, 270, 271, 274, 306, 390, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 438, 442, 443, 445, 448, 449, 451, 453, 455, 457], "rousseau": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "serrano": [25, 80, 162, 169, 175, 270, 396, 409, 410, 411], "l": [25, 79, 80, 111, 117, 118, 119, 162, 169, 175, 192, 197, 198, 199, 220, 229, 256, 257, 270, 390, 391, 392, 393, 397, 400, 407, 428, 430, 433, 437, 438, 440, 443, 445, 448], "2005": [25, 80, 162, 169, 175, 270, 409, 410, 411], "33": [25, 80, 162, 169, 175, 206, 270, 390, 396, 409, 410, 411, 412, 415, 442], "suppl_2": [25, 80, 162, 169, 175, 270], "w382": [25, 80, 162, 169, 175, 270, 409, 410, 411], "w388": [25, 80, 162, 169, 175, 270, 409, 410, 411], "wildtype_pdb_path": [26, 163, 170, 176, 397, 410, 411, 436], "union": [26, 74, 81, 84, 163, 170, 176], "path": [26, 58, 61, 74, 81, 84, 87, 88, 89, 138, 163, 170, 176, 195, 391, 396, 397, 409, 410, 411, 436, 438, 449], "experiment_id": [26, 163, 170, 176, 438], "tmp_folder": [26, 163, 170, 176], "eager_repair": [26, 163, 170, 176, 410, 411], "verbos": [26, 58, 81, 87, 88, 89, 163, 170, 176], "pdb": [26, 81, 84, 85, 86, 87, 88, 89, 163, 169, 170, 176, 256, 257, 393, 397, 410, 411, 436, 441], "file": [26, 80, 81, 82, 84, 85, 86, 87, 88, 89, 110, 117, 138, 163, 169, 170, 176, 256, 257, 324, 336, 390, 391, 393, 395, 397, 409, 436, 438, 442, 443, 445, 448, 449, 453, 455], "amino": [26, 79, 182, 183, 185, 190, 191, 407], "experi": [26, 163, 170, 176, 187, 306, 438], "id": [26, 82, 163, 170, 176, 291, 369, 390, 391, 396, 405, 412, 415, 438, 443], "temporari": [26, 163, 170, 176], "folder": [26, 58, 117, 138, 163, 170, 176, 324, 336, 391, 392, 393, 395, 438, 441], "eagerli": [26, 170], "repair": [26, 80, 81, 163, 170, 176, 436], "print": [26, 45, 58, 81, 87, 88, 89, 111, 163, 170, 176, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 452, 454, 456], "output": [26, 81, 87, 88, 89, 163, 170, 176, 391, 394, 396, 440, 441], "wildtype_residu": [26, 85], "residu": [26, 82, 84, 85, 87, 88, 396], "each": [26, 39, 45, 83, 85, 185, 190, 394, 396, 438, 440, 441, 446, 449], "wildtype_amino_acid": 26, "wildtype_residue_str": [26, 85], "string": [14, 26, 47, 48, 49, 50, 51, 52, 64, 83, 84, 85, 87, 115, 133, 142, 183, 184, 193, 238, 260, 261, 265, 266, 279, 292, 293, 392, 394, 396, 400, 403, 405, 422, 423, 425, 427, 433, 437, 454, 456], "create_working_directori": 26, "work": [26, 45, 74, 81, 111, 138, 315, 319, 371, 383, 392, 393, 395, 396, 399, 404, 422, 423, 436, 437, 438, 440, 442, 443, 444, 448, 455, 457], "directori": [26, 74, 81, 395, 396, 397, 409, 410, 411, 438, 449], "regist": [15, 28, 110, 138, 393, 407, 440], "observer_nam": [55, 77, 109, 111, 435], "delet": 438, "run": [6, 15, 21, 54, 64, 72, 73, 74, 81, 109, 111, 138, 170, 391, 392, 393, 395, 396, 437, 438, 440], "script": [6, 15, 64, 72, 73, 74, 76, 80, 117, 138, 169, 260, 265, 306, 324, 336, 371, 391, 397, 406, 438], "take": [64, 293, 390, 391, 392, 400, 427, 430, 433, 436, 437, 440, 442, 443, 444, 448, 449, 455, 457], "pass": [14, 55, 64, 85, 89, 109, 392, 396, 409, 410, 411, 436], "locat": [80, 320, 328, 396, 454, 456], "note": [58, 64, 65, 77, 81, 163, 170, 176, 427, 430, 448], "must": [39, 393, 400, 407, 428, 430, 433, 449], "accept": [64, 391], "port": [64, 65, 77], "password": [64, 65, 77], "problem_nam": [391, 428, 436], "configur": [110, 449], "dictionari": [64, 436], "problem_factori": [436, 452, 454, 456], "only_avail": [], "includ": [11, 21, 138, 393, 394, 397, 404, 406, 430, 438, 441, 444, 448], "can": [6, 45, 54, 64, 77, 89, 138, 146, 205, 256, 257, 261, 266, 391, 392, 393, 395, 396, 397, 398, 401, 402, 403, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 427, 428, 429, 430, 431, 432, 434, 436, 437, 438, 440, 441, 442, 443, 445, 448, 449, 451, 453, 455], "import": [39, 59, 80, 111, 244, 245, 391, 392, 393, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "directli": [312, 396, 441], "problem_list": [], "repositori": [56, 57, 58, 59, 107, 132, 179, 306, 312, 390, 392, 393, 394, 397, 409, 422, 423, 430, 436, 440, 449], "otherwis": [50, 84, 396, 410, 411], "user": [58, 64, 93, 163, 170, 176, 204, 376, 380, 391, 392, 396, 436, 437, 438, 440, 441], "readili": [], "conda_environment_nam": 391, "python_path": 74, "conda": [6, 74, 117, 138, 324, 336, 371, 392, 394, 397, 409, 437, 441, 442, 443, 445, 448, 449, 453, 455], "environ": [6, 58, 74, 117, 324, 336, 371, 390, 392, 393, 394, 396, 397, 427, 428, 437, 441, 442, 443, 445, 448, 449, 453, 455], "python": [45, 74, 79, 102, 111, 138, 162, 169, 175, 270, 390, 391, 392, 393, 394, 406, 443], "With": [], "instanti": [55, 77, 109, 111, 392, 437, 438], "separ": [], "also": [138, 169, 391, 392, 393, 394, 397, 409, 410, 411, 427, 430, 436, 438, 440, 451], "later": [], "append": [437, 438], "overwrit": [58, 81, 438], "exist": [58, 59, 391, 396, 436], "quiet": [109, 396], "correspond": [118, 133, 183, 337, 396, 407, 427, 455], "objective_repositori": [391, 393, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 440, 441, 442, 444, 446, 448, 449, 451, 452, 454, 455, 456, 457], "yaml": [], "said": [391, 392, 409, 437], "enviro": 437, "sinc": [85, 138, 376, 391, 392, 395, 396, 397, 404, 406, 409, 430, 437, 440, 442, 443, 444, 448, 455, 457], "t": [13, 14, 79, 115, 122, 125, 128, 137, 141, 149, 162, 169, 175, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 270, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 391, 392, 394, 395, 396, 404, 406, 407, 409, 438, 441, 449], "depend": [6, 391, 392, 394, 396, 428, 440, 441, 445, 453], "instal": [57, 163, 170, 176, 394, 396, 410, 411, 428, 436, 440, 441, 449], "squelch": 109, "feedback": [109, 396], "creation": [39, 109, 391, 430, 452], "registr": [117, 260, 265, 324, 336], "conda_environment_loc": [], "extern": [54, 55, 76, 440], "externalobserv": 435, "relev": [371, 392, 396, 409, 430, 436], "script_file_nam": [], "run_script": [64, 74], "call": [39, 58, 64, 76, 77, 109, 117, 163, 170, 176, 324, 336, 391, 392, 393, 394, 395, 396, 409, 436, 438, 440, 441], "monitor": 39, "progress": [39, 58, 89, 437], "valu": [39, 79, 101, 102, 109, 111, 187, 188, 194, 322, 396, 407, 409, 413, 414, 420, 426, 430, 434, 436], "decis": 39, "variabl": [39, 58, 261, 266, 396, 409, 427, 430], "iter": [39, 45, 392, 437, 440, 446, 449], "np": [39, 111, 306, 325, 391, 392, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "ndarrai": [39, 192, 290, 291, 292, 294, 295, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 325, 391, 392, 407, 436, 437, 438, 449], "y": [39, 55, 79, 111, 188, 194, 220, 229, 391, 392, 398, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434, 436, 437, 438], "everi": [39, 438], "time": [39, 65, 391, 396, 416, 417, 427, 438, 452], "initialize_observ": [39, 55, 438], "problem_setup_info": [39, 438], "caller_info": [39, 55, 111, 438], "x0": [21, 55, 391, 392, 393, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 441, 442, 443, 444, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "y0": [21, 55, 392, 409, 428, 436, 437, 440, 442, 443, 444, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "seed": [39, 55, 109, 111, 210, 295, 383, 391, 392, 407, 438, 449], "necessari": [39, 81, 391, 409, 410, 411, 442], "finish": [39, 55, 396, 427, 438], "perform": [39, 101, 102, 118, 163, 176, 261, 266, 390, 392, 394, 396, 427, 436, 437, 444, 446, 448], "ani": [39, 64, 198, 199, 391, 396, 433, 436, 438, 440], "cleanup": 39, "final": [39, 392, 438], "step": [39, 409, 436, 440, 449], "complet": [39, 396, 453], "model": [13, 42, 80, 115, 122, 125, 128, 132, 133, 134, 149, 187, 188, 200, 204, 206, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 274, 283, 286, 304, 331, 334, 341, 390, 391, 396, 397, 398, 401, 402, 403, 404, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 443, 444, 448, 449, 455, 457], "check": [42, 60, 80, 83, 146, 328, 392, 394, 396, 397, 407, 410, 411, 420, 430, 437, 438, 440, 441], "inde": [42, 396, 410, 411], "gener": [44, 45, 64, 74, 99, 100, 101, 102, 109, 111, 220, 229, 337, 390, 392, 396, 407, 412, 415, 424, 427, 442, 443, 444, 448, 449, 455, 457], "chunk_siz": 45, "element": [45, 436, 440], "3": [13, 45, 182, 183, 220, 229, 271, 274, 390, 391, 392, 393, 394, 396, 398, 400, 401, 402, 403, 405, 408, 409, 410, 411, 412, 413, 414, 416, 417, 418, 419, 421, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 440, 443, 444, 446, 451], "12": [45, 80, 150, 242, 244, 245, 256, 257, 390, 397, 409, 410, 411, 420, 426, 430], "replac": [45, 83, 85, 256, 257, 291, 397, 436, 454, 456], "built": [45, 186, 393], "itertool": 45, "doc": [45, 58, 396], "html": [45, 306, 390, 430, 436, 440, 442, 451, 455, 457], "yield": [45, 132, 133, 134, 390, 404], "tupl": [45, 83, 84, 325, 391, 449], "equal": [45, 83], "exampl": [45, 59, 61, 83, 85, 111, 117, 327, 383, 391, 393, 394, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 440, 441, 449, 452], "4": [45, 193, 206, 220, 229, 390, 395, 405, 406, 407, 412, 415, 424, 427, 440, 448, 449], "5": [45, 81, 117, 118, 119, 265, 267, 318, 393, 394, 396, 399, 400, 412, 415, 430, 438, 440, 445, 449, 452], "6": [45, 390, 396, 412, 415, 420, 436, 440], "7": [45, 81, 396, 410, 411, 440], "8": [45, 132, 133, 134, 390, 396, 404, 407, 424, 427, 440], "9": [45, 137, 220, 229, 390, 391, 393, 394, 396, 404, 405, 436, 440, 441], "rdkit": [47, 48, 49, 50, 59, 258, 260, 261, 263, 265, 266, 390, 394, 399, 404, 422, 423, 424], "selfies_str": [48, 51], "chem": [13, 14, 48, 49, 50, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 261, 265, 266, 277, 278, 283, 286, 304, 331, 334, 341], "mol": [48, 49, 50], "convert": [48, 49, 50, 64, 182, 183, 188, 193], "selfi": [14, 48, 50, 51, 52, 115, 133, 142, 238, 246, 260, 261, 265, 266, 279, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 429, 431, 432, 434, 445, 453], "strict": [48, 49, 51, 52, 58, 83], "error": [48, 49, 51, 52, 58, 80], "fail": [48, 261, 266], "decod": [48, 198, 204, 205], "smiles_str": [49, 51, 52], "cannot": [49, 51, 52, 261, 266], "pars": [49, 51, 52, 86, 87, 88, 89, 261, 266, 292], "molecule_str": 50, "from_selfi": [50, 261, 266], "assum": [50, 85, 261, 266, 376, 391, 392, 396, 397, 410, 411, 428, 436, 437, 440, 442], "translat": [51, 52], "els": [51, 52], "those": [51, 52, 392], "aspuru": [51, 52, 390, 424], "guzik": [51, 52, 390, 424], "lab": [51, 52], "group": [51, 52], "isol": [6, 14, 15, 54, 55, 109, 111, 142, 371, 391, 394, 409, 428, 436, 438], "kwargs_for_observ": 55, "send": [55, 77], "verifi": [55, 60, 438, 449], "wa": [55, 57, 85, 244, 245, 392, 396, 406, 427, 436, 437], "correctli": [55, 395], "setup_info": 55, "start": [55, 64, 76, 77, 256, 257, 392, 396, 397, 436, 438, 440, 441], "close": [55, 111, 146, 390, 394, 398, 401, 402, 403, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434], "__getattr__": 55, "__name": 55, "retriev": [55, 77, 143], "attribut": [55, 77, 198, 199, 396, 436, 449], "underli": [55, 405, 412, 449], "download": [56, 57, 58, 60, 138, 391, 395, 397, 409, 436], "github": [56, 57, 58, 59, 138, 391, 392, 393, 394, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "pygithub": [57, 59, 409], "pip": [57, 138, 391, 392, 393, 394, 396, 409, 441, 449], "most": [57, 185, 399, 440], "code": [57, 60, 200, 256, 257, 391, 396, 409], "taken": [57, 312, 397, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 441], "adapt": [57, 271, 274, 390, 394, 396, 446, 448, 451], "gist": 57, "com": [57, 58, 137, 138, 391, 392, 393, 394, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "pdashford": 57, "2e4bcd4fc2343e2fd03efe4da17f577d": 57, "permalink_comment_id": 57, "4274705": 57, "gistcom": 57, "repository_nam": 58, "file_path_in_repositori": 58, "download_path_for_fil": 58, "tag": [58, 59], "master": [58, 393], "commit_sha": [58, 59], "exist_ok": [58, 396, 438], "parent_folders_exist_ok": 58, "i": [58, 79, 118, 146, 162, 169, 175, 187, 261, 266, 270, 274, 322, 337, 371, 390, 392, 394, 396, 397, 404, 407, 411, 433, 437, 438, 449], "repo": [58, 138, 393], "download_path": 58, "branch": [58, 59, 393], "sha": [58, 59], "commit": [58, 59, 397], "exists_ok": 58, "parent": [58, 396, 397, 438, 452], "thei": [21, 58, 80, 146, 244, 245, 246, 396, 407, 420, 438, 448], "do": [58, 138, 244, 245, 391, 392, 396, 409, 420, 427, 437, 441], "except": [58, 65, 77], "github_token_for_poli": [58, 409], "doe": [53, 58, 244, 245], "try": [58, 410, 411], "without": [58, 369, 391, 392, 411, 437], "rate": 58, "limit": [58, 328, 397, 409], "60": 58, "request": [58, 396], "per": 58, "hour": 58, "anonym": [58, 409], "To": [58, 391, 393, 394, 395, 396, 420, 449], "token": [58, 193, 261, 266, 291, 293, 391, 409, 427, 454, 456], "like": [58, 111, 138, 315, 390, 391, 392, 395, 406, 424, 427, 430, 437, 438, 440, 441, 442, 443, 444, 448, 455, 457], "follow": [11, 21, 58, 79, 391, 392, 393, 395, 396, 397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 440, 442, 443, 445, 448, 449, 451, 453, 455, 457], "instruct": [58, 391, 392, 440], "here": [58, 391, 392, 394, 396, 397, 409, 413, 414, 426, 434, 436, 441, 442, 443, 445, 448, 449, 452, 453, 455], "en": [58, 327, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 436, 440, 443, 451, 455], "authent": [58, 64, 65], "keep": [58, 85, 301, 410, 411, 448], "your": [6, 58, 138, 392, 395, 396, 397, 406, 409, 410, 411, 428, 438, 441], "account": 58, "secur": 58, "person": [58, 409], "fine": [58, 393], "grain": 58, "get_repo": 59, "release_2023_09": 59, "068441957858f786c227825d90eb2c43f4f2b000": 59, "internet": 60, "reproduc": 60, "purpos": 60, "make": [60, 301, 380, 393, 395, 396, 397, 409, 427, 452], "sure": [60, 393, 395, 396, 397, 409, 427, 438], "malici": 60, "being": [60, 301, 395, 397, 409], "filepath": 61, "read_mod": 61, "rb": 61, "md5": [61, 397], "hex": 61, "digest": 61, "open": [61, 256, 257, 390, 396, 422, 423, 438, 443], "binari": [61, 81, 138, 163, 170, 176, 396, 409, 410, 411], "form": [11, 61, 146, 390, 394, 396, 407], "mode": [61, 82], "read": [61, 81, 195, 396, 413, 414, 426, 434, 438], "hex_digest": 61, "txt": [61, 81, 85, 391, 395, 396, 409, 410, 411, 438], "d41d8cd98f00b204e9800998ecf8427": 61, "wrap": [62, 63], "interprocess": [62, 63], "commun": [6, 62, 63, 64, 391, 422, 423], "kwargs_for_factori": [64, 109, 111], "connect": [64, 65, 77, 204], "inter": 64, "These": [64, 146, 391, 394, 396, 397, 399, 407, 409, 430, 436, 438, 440], "inner": [64, 371], "up": [64, 65, 392, 404, 406, 427, 437, 438, 449], "listen": 64, "random": [64, 99, 100, 101, 102, 109, 111, 146, 392, 394, 405, 407, 412, 415, 437, 440, 442, 443, 444, 446, 448, 449, 451, 452, 455, 456, 457], "subprocess": [64, 396], "expect": [6, 64, 80, 81, 82, 85, 138, 163, 170, 176, 371, 391, 392, 394, 396, 397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 438, 442, 443, 445, 448, 449, 451, 453, 455, 457], "well": [64, 393, 396, 404, 441, 444], "other": [14, 64, 115, 261, 266, 391, 392, 395, 436, 438, 441], "objective_factori": [64, 369, 391, 393, 409, 428, 438, 440, 443, 445, 453], "determin": 64, "client": 65, "get": [65, 76, 89, 371, 391, 392, 396, 399, 413, 414, 426, 434, 437, 438, 440], "eoferror": 65, "host": 65, "readi": [65, 188], "yet": [65, 391, 437], "connectionrefusederror": 65, "refus": 65, "attempt": 65, "establish": [65, 77], "retri": 65, "befor": [65, 74, 392, 436], "conda_environ": 74, "cwd": [74, 396], "activ": [74, 391, 393, 394, 409, 438, 442, 443, 445, 448, 453, 455], "ad": [74, 138, 369, 406, 438], "current": [74, 413, 414, 426, 428, 434, 440, 441, 449], "either": [14, 133, 142, 279, 396, 397, 407, 409, 428, 438, 451], "mother": [76, 77], "receiv": 77, "wait": 77, "occur": 77, "sent": 77, "back": [77, 289], "quit": [77, 391, 397, 440], "messag": [77, 109], "encod": [79, 191, 192, 204, 205, 409], "For": [79, 85, 138, 187, 242, 256, 257, 328, 376, 391, 394, 396, 406, 409, 430, 438, 440, 441, 446, 449], "amino_acid": 79, "n": [13, 79, 115, 122, 125, 128, 132, 133, 134, 146, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 328, 331, 334, 341, 390, 393, 394, 396, 398, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 430, 431, 432, 433, 434, 438, 449, 451], "d": [79, 256, 257, 306, 322, 390, 395, 397, 407, 430, 438, 453, 455, 457], "c": [79, 132, 133, 134, 390, 393, 396, 398, 401, 402, 403, 404, 405, 407, 408, 412, 413, 414, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 431, 432, 434, 438, 441, 448], "q": [79, 390, 407, 438], "h": [79, 117, 118, 119, 274, 294, 390, 398, 401, 402, 403, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 438], "k": [13, 14, 79, 115, 122, 125, 128, 137, 141, 146, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 260, 277, 278, 283, 286, 304, 318, 331, 334, 341, 390, 407, 438, 449], "m": [79, 137, 193, 256, 257, 390, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 438, 442, 443, 445, 448, 449, 451, 453, 455, 457], "p": [79, 390, 407, 438], "v": [79, 81, 407, 438], "measur": [80, 115, 187, 238, 396, 422, 423], "stabil": [80, 81, 165, 169, 170, 172, 175, 256, 257, 268, 270, 390, 393, 394, 396, 399, 410, 441, 449], "sasa": [80, 81, 158, 162, 163, 164, 172, 175, 176, 177, 268, 270, 394, 399, 410, 411], "foldxinterfac": 80, "queri": [80, 146, 391, 392, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 437], "heavili": [6, 80, 396], "inspir": [80, 396], "wai": [21, 80, 392, 393, 396, 407, 437, 438, 440, 441], "lambo": [80, 138, 150, 242, 244, 245, 246, 394, 396, 399, 410, 411, 436], "automat": [80, 111, 390, 391, 395], "acceler": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "bayesian": [80, 150, 242, 244, 245, 376, 390, 392, 394, 409, 410, 411, 420, 437, 443, 445, 453], "biolog": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "design": [13, 80, 115, 122, 125, 128, 132, 133, 134, 137, 149, 150, 204, 220, 223, 226, 229, 232, 235, 238, 241, 242, 244, 245, 250, 253, 283, 286, 304, 331, 334, 341, 390, 391, 392, 394, 395, 398, 399, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 425, 426, 429, 431, 432, 434, 436, 437, 440, 449], "withdenois": 80, "autoencod": [80, 150, 204, 242, 244, 245, 390, 409, 410, 411, 420, 442, 443, 444, 448, 455, 457], "stanton": [80, 146, 150, 242, 244, 245, 390, 395, 396, 407, 409, 410, 411, 420, 436, 449], "samuel": [80, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 449, 453], "weslei": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "maddox": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "nate": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420, 449], "gruver": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420, 449], "phillip": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "maffetton": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "emili": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "delanei": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "peyton": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "greensid": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "andrew": [80, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 449], "gordon": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "wilson": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420, 449], "arxiv": [13, 80, 146, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 445, 448], "juli": [80, 150, 242, 244, 245, 390, 409, 410, 411, 412, 415, 420], "ab": [13, 80, 146, 150, 242, 244, 245, 390, 407, 409, 410, 411, 420, 445, 448], "2203": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "12742": [80, 150, 242, 244, 245, 390, 409, 410, 411, 420], "samuelstanton": [80, 138, 409], "working_dir": [81, 396], "interact": [81, 396], "engin": [81, 306, 430, 440, 444], "softwar": [81, 395, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "where": [81, 117, 118, 119, 205, 391, 392, 394, 396, 427, 437, 441, 442, 443, 445, 448, 449, 453, 455], "store": [81, 392, 397, 436, 441, 449], "pdb_file": 81, "remove_and_renam": 81, "ph": [81, 396, 410, 411], "remove_heteroatom": 81, "_repair_if_necessary_and_provide_path": 81, "_simulate_mut": 81, "_read_energi": 81, "_compute_sasa": 81, "solvent": [81, 158, 163, 164, 172, 176, 177, 268, 390, 394, 396, 399], "surfac": [81, 158, 163, 164, 172, 176, 177, 268, 394, 396, 399, 410], "area": [81, 158, 163, 164, 172, 176, 177, 268, 394, 396, 399, 410], "compute_st": 81, "structur": [81, 87, 88, 89, 138, 170, 392, 396, 406, 438], "compute_sasa": 81, "compute_stability_and_sasa": 81, "singl": [81, 85, 256, 257, 306, 390, 394, 397, 399, 420, 422, 423, 430, 436, 438, 444, 451], "copy_foldx_fil": 81, "copi": [81, 391, 392, 396, 437, 452], "write_mutations_to_fil": 81, "wildtype_resiud": 81, "output_dir": 81, "write": [81, 138, 371, 391, 393, 396, 406, 435, 438, 439, 447, 450], "stdout": 81, "previou": [81, 396, 438], "reli": [81, 369, 430, 448, 455], "rotabas": [81, 395, 396, 409, 410, 411], "longer": 81, "manipul": [82, 391, 393], "accord": [82, 186, 396, 440], "certain": [82, 128, 146, 304, 331, 394, 396, 403, 404, 407, 425, 455], "first": [82, 83, 85, 391, 392, 394, 396, 399, 400, 436, 437], "letter": [82, 85, 117, 118, 119, 394, 396, 399, 400], "second": [82, 83, 85, 196, 394, 396, 399], "posit": [82, 83, 85, 185, 190, 392, 396, 397, 436, 437, 440], "third": [82, 85], "chain": [82, 85, 396, 397], "fourth": [82, 85], "mutant": [82, 84, 85, 256, 257, 392, 396, 437, 449], "foldxsuit": [82, 395, 396], "crg": [82, 395, 396], "eu": [82, 395, 396], "string_1": 83, "string_2": 83, "edit": [83, 256, 257, 397], "oper": [83, 395], "assertionerror": 83, "abc": 83, "abd": 83, "def": [83, 391, 392, 437, 438], "wildtype_pdb_fil": [84, 410, 411], "mutated_residue_str": [84, 85], "return_hamming_dist": 84, "find": [84, 117, 118, 119, 138, 391, 397, 404, 406, 438, 440, 442, 443, 445, 448, 449, 453, 455], "closest": 84, "ham": 84, "distanc": [84, 85, 118, 397, 400], "along": 84, "best": [84, 392, 436, 437, 446, 449, 452], "candid": [84, 392, 440], "found": [84, 393, 396, 436, 440], "bio": [85, 88, 89, 396], "individual_list": [85, 396], "levenshtein": 85, "track": [85, 390, 438], "written": 85, "line": [85, 394, 396], "ea1r": 85, "still": [85, 441], "need": [11, 85, 138, 391, 392, 395, 396, 406, 409, 410, 411, 436, 438], "dummi": 85, "itself": [85, 391, 393], "ecd": 85, "acd": 85, "would": [85, 391, 392, 396, 397, 438], "ea1a": 85, "load": [86, 110, 179, 187, 196, 396, 438, 449], "them": [86, 138, 376, 391, 392, 393, 396, 397, 399, 406, 437, 440, 445, 453], "path_to_pdb": [87, 88, 89], "structure_nam": [87, 88, 89], "done": [89, 138, 396, 409, 420, 440], "quietli": 89, "some": [89, 200, 246, 376, 392, 393, 396, 409, 430, 438, 440], "get_structur": [89, 396], "pdbparser": [89, 396], "numpi": [101, 271, 292, 391, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 428, 429, 430, 431, 432, 433, 434, 438, 441, 442, 443, 444, 445, 448, 449, 451, 452, 453, 454, 455, 456, 457], "obj": [], "dynam": 391, "intern": [390, 391, 412, 415, 424, 428, 451], "constructor": [], "factory_kwarg": [], "processwrapp": [], "how": [138, 391, 392, 393, 394, 396, 399, 436, 437, 438, 440], "objective_nam": [], "loop": [369, 390, 442, 443, 444, 448, 455, 457], "process_wrapp": [], "observer_init_info": 109, "force_regist": [], "force_isol": [4, 14, 109, 111, 133, 142, 163, 170, 176, 210, 246, 261, 279, 391, 407], "instantiant": 109, "associ": [109, 390, 436, 441, 442, 457], "caller": [109, 111, 438], "forward": [109, 111, 438], "logger": [109, 111], "ask": 392, "confirm": [], "By": [109, 261, 266, 325, 391, 392, 407, 410, 411, 444, 449, 451], "onc": [109, 391, 392, 427, 440], "round": [109, 337], "down": 109, "give": [109, 290, 376, 391], "config": [110, 371, 449], "configpars": 110, "just": [53, 111, 391, 409, 436, 438], "One": [111, 395, 440, 451], "aloha": [111, 393, 394, 399, 436, 437, 440, 452], "arrai": [111, 182, 183, 192, 193, 289, 292, 294, 391, 393, 394, 398, 400, 401, 402, 403, 404, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 438, 440, 441, 453], "reshap": [111, 392, 420, 422, 427, 442, 443, 444, 448, 451, 455, 457], "simpl": [117, 118, 119, 132, 133, 134, 186, 260, 261, 265, 266, 392, 436, 437, 440], "goal": [117, 118, 119, 301], "o": [117, 118, 119, 390, 398, 400, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 438, 441, 448], "among": [115, 117, 118, 119, 395, 396], "poli__bas": [117, 324, 336], "yml": [117, 138, 324, 336, 392, 397, 409, 442, 443, 445, 448, 453, 455], "simultan": [14, 118, 133, 142, 261, 266, 279, 397], "map": [118, 133], "symbol": [118, 133], "main": [6, 118, 261, 266, 392, 393, 394, 395, 396, 437, 438], "api": [132, 133, 134, 393, 409], "assess": [132, 133, 134, 256, 257, 394, 399], "small": [132, 133, 134, 261, 391, 393, 404, 405, 406, 424, 438, 440], "protein": [132, 133, 134, 146, 162, 169, 170, 175, 256, 257, 270, 390, 393, 395, 397, 404, 406, 407, 440, 441, 449], "easi": [132, 133, 134, 146, 390, 396, 404, 407, 440], "molecular": [13, 115, 122, 125, 128, 132, 133, 134, 137, 149, 162, 169, 175, 223, 226, 232, 235, 238, 241, 250, 253, 270, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "better": [132, 133, 134, 390, 396, 404], "benchmark": [13, 21, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 306, 324, 328, 331, 334, 341, 390, 392, 398, 399, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 430, 431, 432, 434], "ligand": [132, 133, 134, 390, 394, 399, 404], "garc\u00eda": [132, 133, 134, 390, 404], "orteg\u00f3n": [132, 133, 134, 390, 404], "miguel": [132, 133, 134, 390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "gregor": [132, 133, 134, 390, 404], "simm": [132, 133, 134, 390, 404], "austin": [132, 133, 134, 390, 404], "tripp": [132, 133, 134, 390, 404], "jos\u00e9": [132, 133, 134, 256, 257, 390, 397, 404], "hern\u00e1ndez": [132, 133, 134, 390, 404], "lobato": [132, 133, 134, 390, 404], "andrea": [132, 133, 134, 390, 404, 451], "bender": [132, 133, 134, 390, 404], "sergio": [132, 133, 134, 390, 404], "bacallado": [132, 133, 134, 390, 404], "journal": [132, 133, 134, 137, 220, 229, 390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 431, 432, 434, 449], "62": [132, 133, 134, 390, 404], "15": [132, 133, 134, 390, 404, 414, 452], "august": [132, 133, 134, 390, 404], "3486": [132, 133, 134, 390, 404], "3502": [132, 133, 134, 390, 404], "1021": [13, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "ac": [13, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 427, 429, 431, 432, 434], "jcim": [13, 115, 122, 125, 128, 132, 133, 134, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1c01334": [132, 133, 134, 390, 404], "target_nam": [133, 404, 441], "string_represent": [14, 133, 142, 246, 261, 266, 279, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 422, 423, 425, 426, 429, 431, 432, 434, 445, 453], "liter": [14, 133, 142, 210, 246, 261, 266, 279, 328], "There": [138, 413, 414, 426, 434, 436, 438], "sever": [138, 306, 315, 324, 396, 397, 416, 417], "prepare_receptor": 138, "rest": [138, 438, 440], "descript": [138, 438], "show": [138, 393, 396, 436], "center": [138, 406], "websit": [138, 406], "scripp": 138, "edu": [138, 220, 229], "uncompress": [138, 406], "add": [138, 187, 290, 391, 392, 409, 410, 411, 420, 437, 453], "export": [138, 406], "autodock_vina": [138, 406], "bin": [138, 406], "bashrc": [138, 406], "zshrc": [138, 406], "bash": 138, "In": [137, 138, 242, 246, 390, 392, 393, 396, 397, 406, 409, 410, 411, 427, 428, 430, 436, 437, 438, 440, 441, 446, 451, 452, 453], "ccsb": 138, "sh": [138, 406], "thu": [138, 406], "might": [138, 306, 391, 393, 396, 406, 409, 410, 411, 420, 430, 436, 438], "chang": [138, 162, 169, 175, 179, 196, 270, 393, 395, 396, 406, 411, 430], "its": [11, 21, 138, 392, 396, 406, 410, 437, 441], "permiss": [138, 406], "chmod": [138, 406], "abl": [138, 391, 393, 395, 396, 406, 427, 438, 440, 441], "pyscreen": [138, 406], "howev": [138, 397, 406], "sometim": [138, 406], "problemat": [138, 406], "ha": [138, 315, 325, 391, 392, 396, 406, 413, 414, 436, 437, 441, 446], "symlink": [138, 406], "ln": [138, 406], "sf": [138, 406], "easili": [138, 396, 436], "env": [138, 391, 393, 409, 436, 440, 441, 442, 443, 445, 448, 453, 455], "src": [93, 138, 409, 442, 443, 445, 448, 453, 455], "ddr3_dock": 138, "task": [115, 122, 125, 128, 137, 138, 141, 149, 150, 196, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 396, 398, 401, 402, 403, 405, 408, 409, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 444], "git": [138, 391, 392, 393, 394, 409], "clone": [138, 393, 397, 409, 428, 442, 443, 445, 448, 453, 455], "431b052": [138, 409], "cd": [138, 393, 409], "particular": [138, 246, 268, 409, 430, 436, 438, 441], "proxy_rfp": [138, 409], "proxyrfptask": [138, 409], "rfp": [138, 150, 152, 153, 268, 394, 399, 449], "asset": [138, 409], "fpbase": [138, 409], "And": [138, 436], "now": [138, 391, 393, 396], "py": [6, 93, 138, 328, 392, 393, 396, 436, 437, 438, 440, 441], "query_exampl": 138, "ddr3": [], "et": [13, 14, 115, 122, 125, 128, 137, 141, 146, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 274, 277, 278, 283, 286, 304, 331, 334, 341, 390, 394, 395, 396, 397, 398, 399, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 431, 432, 434, 436, 442, 443, 444, 445, 448, 449, 451, 452, 453, 455, 457], "al": [13, 14, 115, 122, 125, 128, 137, 141, 146, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 271, 274, 277, 278, 283, 286, 304, 306, 328, 331, 334, 341, 390, 394, 395, 396, 397, 398, 399, 401, 402, 403, 404, 405, 406, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 430, 431, 432, 434, 436, 442, 443, 444, 445, 448, 449, 451, 452, 453, 455, 457], "nat": [13, 14, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "biol": [13, 14, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "1036": [13, 14, 115, 122, 125, 128, 137, 141, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 277, 278, 283, 286, 304, 331, 334, 341], "self": [14, 142, 391, 392, 397, 437, 438], "tdcblackbox": [], "denois": [150, 242, 244, 245, 390, 409, 410, 411, 420], "alia": [], "base_candid": [], "specifc": [], "predict": [137, 158, 186, 187, 207, 256, 257, 390, 394, 396, 399, 444], "pair": [162, 175, 270], "biopython": [162, 169, 175, 270, 396, 410, 441], "cock": [162, 169, 175, 270], "pa": [162, 169, 175, 270], "antao": [162, 169, 175, 270], "jt": [162, 169, 175, 270], "chapman": [162, 169, 175, 270], "ba": [162, 169, 175, 270], "cox": [162, 169, 175, 270], "cj": [162, 169, 175, 270], "dalk": [162, 169, 175, 270], "friedberg": [162, 169, 175, 270], "hamelryck": [162, 169, 175, 270], "kauff": [162, 169, 175, 270], "wilczynski": [162, 169, 175, 270], "b": [162, 169, 175, 270, 294, 391, 393, 400, 427, 428, 430, 433, 438, 440, 442], "de": [13, 115, 122, 125, 128, 137, 149, 162, 169, 175, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 270, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "hoon": [162, 169, 175, 270], "mjl": [162, 169, 175, 270], "2009": [162, 169, 175, 270, 390, 424, 427], "freeli": [162, 169, 175, 270], "tool": [162, 169, 175, 270, 441], "bioinformat": [162, 169, 175, 270], "25": [162, 169, 175, 270, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1422": [162, 169, 175, 270], "1423": [162, 169, 175, 270], "usual": [6, 115, 238, 321, 324, 391, 392, 394, 399, 430, 438, 444, 448], "eager": [163, 176], "v5": [163, 170, 176], "compil": [163, 170, 176, 206, 397], "specif": [128, 163, 170, 176, 430, 440], "foldxblackbox": [], "pre": [169, 393, 397, 410, 411, 441], "20": [390, 407, 427], "shown": [], "core": [380, 391, 392, 435, 436, 437, 442, 448, 452, 455], "through": [125, 137, 170, 304, 331, 390, 392, 393, 405, 437, 440], "total": [170, 186, 396], "cba": [179, 196, 198], "vae": [179, 196, 198, 199, 205, 206, 210, 442, 443, 444, 448, 455, 457], "sb": [179, 196], "bo": 179, "minor": [179, 196], "modif": [179, 196], "conduct": [179, 196], "rm": [179, 196], "creator": [179, 196], "last": [179, 196, 396], "x_aa": [182, 183, 192], "aa_idx": 182, "arn": [182, 183], "becom": [182, 183, 396], "row": [182, 183, 396], "base_seq": 184, "wild": [184, 189, 396], "mtuation": 184, "xt_p": [185, 190], "categor": [185, 190, 208], "probabl": [185, 190], "distribut": [185, 190, 208, 390, 446], "pred": 186, "xt": 186, "predictor": 186, "balaji": 186, "lakshminarayanan": 186, "paper": [186, 198, 220, 229, 390, 407, 441, 442, 457], "scalabl": [186, 390, 457], "uncertainti": [186, 390, 444, 455], "estim": [186, 242, 263, 265, 266, 267, 390, 393, 394, 399, 424], "deep": [137, 186, 256, 257, 390, 397, 405, 427, 442, 443, 444, 448, 455, 457], "ensembl": 186, "2017": [137, 186, 220, 229, 390, 397, 405], "varianc": 186, "random_st": [187, 194], "train_siz": [187, 194], "5000": 187, "return_test": [187, 194], "return_al": 187, "gfp": [187, 188, 189, 195], "test": [146, 187, 306, 390, 392, 407, 430, 437], "ground": [187, 427], "truth": 187, "gp": [187, 210, 211], "partit": [187, 194, 422], "below": 187, "20th": 187, "percentil": [187, 194], "nois": [187, 335, 336, 337, 383, 394, 399, 440], "data_df": 188, "panda": [188, 195, 396], "datafram": [188, 195, 396], "functional_onli": [188, 210], "ignore_stop": [188, 210], "return_str": 188, "raw": 188, "sampl": [13, 146, 190, 295, 390, 405, 407, 412, 415, 433, 438, 444, 454, 455, 456], "aa_str": 191, "pad": [191, 193, 290, 391, 453], "hot": [191, 294], "onehot": 192, "alphabet_s": [192, 392, 437], "dna_str": 193, "base_ord": 193, "atcg": 193, "40": 194, "1000": 194, "df_save_fil": 195, "bright": 195, "author": [196, 242, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "credit": 196, "herculean": 196, "go": [196, 394, 395], "aa": [197, 198, 199, 274], "mimic": 198, "kera": [198, 204], "latent_dimension": [198, 199], "enc1_unit": [198, 199, 206], "train": [200, 405, 412, 415, 455], "gaussian": [200, 336, 337, 390, 394, 399, 433, 444, 455], "regress": 200, "sarkisyan": 200, "2016": [200, 390, 427, 442, 443, 444, 448, 455, 457], "plu": [200, 452], "constant": [200, 430, 448], "input_shap": [204, 205], "latent_dim": [204, 205, 206], "variat": [204, 442, 443, 444, 448, 455, 457], "via": [204, 390, 438, 451, 453, 457], "latent": [204, 390, 392, 427, 437, 442, 443, 444, 448, 455, 457], "space": [204, 291, 376, 390, 392, 427, 437, 442, 443, 444, 445, 448, 451, 453, 455, 457], "flatten": [205, 392, 427, 436, 437], "basic": [205, 369, 440], "layer": 205, "n_token": 206, "seq_length": 206, "50": [206, 446], "eps_std": 206, "y_true": [207, 208], "y_pred": [207, 208], "likelihood": 208, "uniqu": [210, 438], "problem_typ": [210, 211], "exact": [242, 392, 437], "logp": [242, 244, 245, 246, 258, 260, 261, 394, 399], "jointli": 242, "quantit": [242, 263, 265, 266, 267, 393, 394, 399], "druglik": [242, 263, 265, 266, 267, 393, 394, 399], "qed": [242, 261, 263, 265, 266, 267, 394, 399], "penal": [242, 246, 394, 399], "solubl": [242, 258, 260, 261, 394, 399], "fair": 242, "comparison": [242, 438], "_exactly_": [244, 245], "adjust": 246, "magic": 246, "empir": [246, 420], "standard": [21, 246, 336, 337, 420, 433, 448], "deviat": [246, 420], "dataset": [220, 229, 246, 306, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 429, 430, 431, 432, 434], "todo": [396, 435, 439, 447, 450], "rapid": [256, 257, 390, 394, 399], "sourc": [256, 257, 390, 391, 422, 423, 443], "bird": [256, 257], "ey": [256, 257], "view": [256, 257, 396], "collect": [256, 257, 305, 394, 397, 407], "site": [256, 257, 436, 440, 441], "reader": [256, 257], "consid": [256, 257, 397, 407, 427, 430], "drop": [256, 257, 397, 436, 440], "rosetta": [256, 257, 397], "learn": [137, 256, 257, 390, 397, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 443, 451], "blaabjerg": [256, 257, 390, 397], "lass": [256, 257, 390, 397], "maher": [256, 257, 390, 397], "kassem": [256, 257, 390, 397], "lydia": [256, 257, 390, 397], "good": [256, 257, 390, 391, 393, 394, 397, 427], "nicola": [256, 257, 390, 397], "jonsson": [256, 257, 390, 397], "matteo": [256, 257, 390, 397], "cagiada": [256, 257, 390, 397], "kristoff": [256, 257, 390, 397], "johansson": [256, 257, 390, 397, 424], "wouter": [256, 257, 390, 397], "boomsma": [256, 257, 390, 397], "ameli": [256, 257, 390, 397], "stein": [256, 257, 390, 397], "kresten": [256, 257, 390, 397], "lindorff": [256, 257, 390, 397], "larsen": [256, 257, 390, 397], "faraldo": [256, 257, 397], "g\u00f3mez": [256, 257, 390, 397, 442, 443, 444, 448, 455, 457], "detlef": [256, 257, 397], "weigel": [256, 257, 397], "nir": [256, 257, 397], "ben": [256, 257, 390, 397, 442], "tal": [256, 257, 397], "julian": [256, 257, 390, 397, 427], "echav": [256, 257, 397], "elif": [256, 257, 390, 397], "2023": [256, 257, 390, 395, 397], "e82593": [256, 257, 390, 397], "7554": [256, 257, 390, 397], "82593": [256, 257, 390, 397], "whose": [260, 265, 336, 409, 444, 449], "quotient": [260, 394, 399], "descriptor": 260, "both": [115, 122, 125, 128, 137, 149, 223, 226, 232, 235, 238, 241, 250, 253, 260, 265, 283, 286, 304, 331, 334, 341, 396, 410, 411], "poli__chem": [], "want": [391, 392, 396, 410, 411, 440], "local": [271, 274, 315, 390, 393, 428, 438, 442, 443, 445, 448, 453, 455, 457], "environemnt": [], "extra": [391, 441], "interest": [393, 396, 397, 410, 411, 428, 430, 438, 440, 449], "molfromsmil": [261, 266], "known": [21, 261, 266, 422, 436], "silent": [261, 266], "nan": [261, 266, 427], "someth": [261, 266, 391, 392, 427], "than": [261, 266, 376, 442, 443, 445, 448, 449, 453, 455], "continu": [21, 265, 267, 305, 306, 324, 325, 376, 390, 399, 440, 445], "lipinski": [265, 267], "rule": [265, 267, 391], "strongli": [], "advic": 391, "heurist": 267, "discard": 267, "too": 267, "heavi": [267, 391], "pareto": 268, "front": 268, "accessibl": 275, "sa": [275, 394, 399, 424], "toi": [287, 305, 306, 324, 325, 328, 335, 337, 376, 392, 400, 427, 438, 452], "avout": 287, "super": [287, 301, 391, 392, 399, 437], "mario": [287, 291, 301, 390, 399], "bro": [287, 301, 399], "level": [287, 289, 290, 291, 292, 293, 294, 295, 301, 390, 396, 399, 427], "n_pad": 290, "left": 290, "room": 290, "agent": [290, 427], "land": 290, "clean": [291, 396], "remov": [291, 395, 410, 411], "11": [291, 294, 393, 404, 424, 441], "empti": 291, "level_txt": [292, 293], "n_sprite": 294, "integ": [294, 295, 392, 430, 433, 437, 440], "levels_onehot": 295, "probit": 295, "tensor_level": [], "torch": [], "tensor": [], "level_s": [], "14": 427, "could": [391, 392, 396, 397, 409, 436, 437, 440, 451], "mariogan": 427, "jar": 391, "prob_matrix": 297, "item": [297, 388], "sentenc": [], "shape": [11, 391, 392, 393, 400, 428, 430, 433, 437, 440, 453], "z_dim": [], "devic": [146, 407], "path_to_state_dict": [], "vaemario": [], "pretrain": [], "landscap": [271, 274, 306], "signatur": 306, "sign": [306, 430], "flip": [306, 430], "becaus": [306, 441], "re": [306, 390, 393, 396, 397, 437, 438, 442], "deal": 306, "ali": [306, 390, 430], "roomi": [306, 328, 390, 430], "2015": [306, 390, 430], "unconstrain": [306, 328, 390, 430], "www": [306, 390, 424, 430], "halifax": [306, 430], "nova": [306, 430], "scotia": [306, 430], "canada": [306, 430], "dalhousi": [306, 430], "univers": [306, 430], "electr": [306, 430], "surjanov": [306, 390, 430], "bingham": [306, 390, 430], "virtual": [306, 427], "sfu": [306, 390, 430], "ca": [306, 390, 430], "ssurjano": [306, 390, 430], "linebo": [312, 430, 451], "kirschnj": 312, "xy": [315, 319, 320], "cross": 315, "trai": 315, "maxima": [315, 319], "quilt": 315, "pattern": [128, 315, 392], "2d": [315, 319, 320, 376], "alpha": [318, 393, 444], "veri": 319, "flat": 319, "pi": 319, "egg": 320, "holder": 320, "especi": [320, 394], "difficult": 320, "know": [320, 392, 396, 436, 449], "optima": [320, 328], "squar": 321, "norm": 321, "shift": 321, "awai": [321, 397], "bit": [321, 396], "normal": [322, 390, 441, 446], "903534": 322, "39": [322, 409], "16599": 322, "divid": 322, "dimens": [324, 325, 328, 376, 390, 430, 444, 448, 451], "focu": [324, 396, 436, 440], "ones": 324, "dimension": [324, 376, 390, 394, 442, 445, 448, 451, 455], "function_nam": [325, 430, 442, 443, 444, 448, 451, 455, 457], "n_dimens": [325, 430, 442, 443, 444, 446, 448, 451, 455, 457], "embed_in": [325, 328, 430], "randomli": [146, 325, 392, 407, 430, 436, 437, 440, 452, 454, 456], "embed": [325, 376, 390, 394, 430, 445], "emb": [325, 376, 430], "toycontinuousproblem": 325, "bound": [325, 443, 448], "lower": [325, 376], "upper": 325, "seri": 327, "testb": 327, "wikipedia": 327, "wiki": 327, "test_functions_for_optim": 327, "ackley_function_01": [328, 394, 399, 430, 442, 443, 444, 448, 451, 455, 457], "alpine_01": [328, 430], "alpine_02": [328, 430], "bent_cigar": [328, 430], "brown": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 328, 331, 334, 341, 390, 398, 399, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 430, 431, 432, 434], "chung_reynold": [328, 430], "cosine_mixtur": [328, 430], "deb_01": [328, 430], "deb_02": [328, 430], "deflected_corrugated_spr": [328, 430], "styblinski_tang": 328, "shifted_spher": [328, 430], "easom": [328, 394, 399, 430], "cross_in_trai": [328, 430], "egg_hold": [328, 430], "camelback_2d": [328, 430], "n_dim": 328, "definit": [328, 430], "white": [335, 336, 383, 394, 399, 440], "vector": [337, 407], "downward": 337, "exemplifi": 369, "Not": 369, "come": [11, 369, 404, 440], "benefit": 369, "intellisens": 369, "spawn": 391, "higher": [376, 396], "afford": 376, "intrins": 376, "actual": [376, 405, 412, 430], "readm": [], "verbatum": [], "fullnam": 388, "escap": 388, "underlin": 388, "block": 388, "rubric": 388, "endfor": 388, "endif": 388, "endblock": 388, "ar15": 390, "url": [390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "bkj": 390, "maximilian": [390, 453], "balandat": [390, 444, 451, 453], "brian": 390, "karrer": 390, "daniel": 390, "jiang": 390, "daulton": [390, 394, 453], "benjamin": [390, 424], "letham": [390, 442], "eytan": [390, 442, 453], "bakshi": [390, 442, 453], "botorch": [390, 444, 451, 457], "framework": [390, 427], "effici": [13, 390, 405, 412, 415, 438, 444], "mont": 390, "carlo": 390, "decemb": 390, "2020": [220, 229, 390, 412, 415, 424, 442, 444, 451, 452], "1910": 390, "06403": 390, "cs": [390, 407, 445, 448], "math": 390, "stat": [390, 448], "bkg": 390, "23": [390, 393], "bf17": 390, "je": 390, "frellsen": [390, 397], "spheric": 390, "convolut": [390, 427], "applic": [271, 274, 390], "guyon": 390, "u": [390, 438, 455], "von": 390, "luxburg": 390, "bengio": 390, "wallach": 390, "fergu": 390, "vishwanathan": 390, "garnett": 390, "editor": [390, 397], "advanc": [390, 442, 443, 449, 453, 457], "neural": [390, 397, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 443, 449, 453, 457], "system": [390, 395, 396, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 443, 449, 453, 457], "volum": [390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 442, 449, 457], "30": [390, 430], "curran": [390, 442, 457], "inc": [390, 442, 457], "proceed": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 442, 451, 455, 457], "neurip": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 442, 457], "cc": [390, 398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 441, 442, 457], "paper_fil": 390, "1113d7a76ffceca1bb350bfe145467c6": 390, "pdf": [220, 229, 390], "dpam02": 390, "deb": [390, 452], "pratap": 390, "agarw": 390, "meyarivan": 390, "fast": 390, "elitist": 390, "multiobject": 390, "genet": [271, 274, 390, 427, 452], "nsga": 390, "ii": [371, 390, 397, 407], "ieee": [390, 427], "transact": 390, "evolutionari": [390, 392, 394, 427, 437, 446], "182": 390, "197": 390, "april": [390, 422, 423, 427, 430], "2002": [390, 452], "1109": [390, 427], "4235": 390, "996017": 390, "gfsc22": 390, "matter": [13, 390, 405, 412, 415], "practic": [13, 390, 405, 412, 415], "thirti": [390, 455], "sixth": 390, "confer": [390, 412, 415, 427, 451, 455], "openreview": [390, 405, 412, 415, 443], "net": [390, 405, 412, 415, 443], "forum": [390, 405, 412, 415, 443], "yczrdi0y7g": [390, 405, 412, 415], "gost": 390, "22": [390, 396], "dockstr": [390, 391, 394, 399, 436, 440, 441], "gpb": 390, "jacob": [390, 427, 457], "gardner": [390, 444, 457], "geoff": 390, "pleiss": 390, "david": [390, 446, 453, 455, 457], "bindel": 390, "kilian": 390, "weinberg": 390, "gpytorch": [390, 444], "blackbox": 390, "matrix": [390, 446], "infer": 390, "gpu": 390, "2018": [220, 229, 390, 412, 415, 427, 442, 443, 444, 448, 455, 457], "gbwd": 390, "rafael": 390, "bombarelli": [390, 442, 443, 444, 448, 455, 457], "jennif": 390, "wei": 390, "duvenaud": 390, "benjam\u00edn": 390, "s\u00e1nchez": 390, "lengel": [390, 424], "denni": 390, "sheberla": 390, "jorg": 390, "aguilera": 390, "iparraguirr": 390, "timothi": 390, "hirzel": 390, "ryan": [390, 457], "adam": [390, 427], "al\u00e1n": [390, 424], "driven": 390, "central": 390, "268": 390, "276": 390, "februari": 390, "acscentsci": 390, "7b00572": 390, "ho96": 390, "hansen": [390, 446], "ostermei": [390, 446], "arbitrari": 390, "evolut": [390, 452], "strategi": [390, 394, 446], "covari": [390, 446], "312": 390, "317": 390, "1996": [390, 446], "icec": 390, "542381": 390, "hfg": 390, "21": [390, 436, 440], "machin": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 451], "drug": [220, 229, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 440], "discoveri": [390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "develop": [390, 391, 392, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 437, 443], "fifth": [], "2021": [390, 398, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 455], "8nvgnornowr": [], "jrhernandezgarcia": 390, "moksh": 390, "jain": [390, 395], "sharath": 390, "chandra": 390, "raparthi": 390, "alex": [390, 424], "hern": 390, "\u00e1": 390, "ndez": 390, "garc": 390, "\u0131": 390, "jarrid": 390, "rector": 390, "brook": 390, "yoshua": 390, "santiago": 390, "miret": 390, "emmanuel": 390, "gf": 390, "low": [21, 390], "kraus": [390, 451], "emma": 390, "brunskil": 390, "kyunghyun": [390, 407, 449], "cho": [146, 390, 407, 449], "barbara": 390, "engelhardt": 390, "sivan": 390, "sabato": 390, "jonathan": 390, "scarlett": 390, "40th": 390, "202": 390, "14631": 390, "14653": 390, "pmlr": [390, 412, 415, 451, 455], "29": 390, "jul": [390, 409, 410, 411, 412, 415], "mlr": [390, 451, 455], "press": [390, 451, 455], "v202": 390, "jain23a": 390, "kmh": 390, "19": 390, "johann": [390, 451], "kirschner": [390, 451], "mojmir": [390, 451], "mutni": [390, 451], "nicol": [390, 451], "hiller": [390, 451], "rasmu": [390, 451], "ischebeck": [390, 451], "safe": [390, 451], "high": [21, 390, 394, 442, 445, 448, 451, 455], "subspac": [390, 394, 451], "36th": [390, 451], "3429": [390, 451], "3438": [390, 451], "2019": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 399, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 451, 457], "v97": [390, 451], "kirschner19a": [390, 451], "ssw": 390, "16": [390, 396, 443], "bobak": 390, "shahriari": [390, 442, 443, 444, 448, 455, 457], "kevin": 390, "swerski": 390, "ziyu": 390, "wang": 390, "nando": 390, "freita": 390, "human": [390, 442, 443, 444, 448, 455, 457], "out": [390, 392, 398, 400, 401, 402, 403, 405, 407, 408, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 429, 430, 431, 432, 433, 434, 440, 442, 443, 444, 448, 455, 457], "review": 390, "104": 390, "148": 390, "175": 390, "januari": 390, "jproc": 390, "2494218": 390, "sr73": 390, "shrake": [390, 396], "ruplei": [390, 396], "exposur": 390, "atom": 390, "lysozym": 390, "insulin": 390, "79": [274, 390], "351": 390, "371": 390, "sep": [390, 405], "1973": [390, 396], "1016": 390, "0022": 390, "2836": 390, "73": 390, "90011": 390, "smg": 390, "preprint": [146, 390, 407, 409, 410, 411, 420], "blankdeb20": 390, "blank": [390, 452], "pymoo": [390, 452], "89497": 390, "89509": 390, "tutori": [391, 396, 436, 438, 442, 443, 444, 448, 449, 455, 457], "cover": 391, "what": [391, 397, 413, 414, 426, 434, 436, 449], "look": [391, 392, 437, 449], "poli": [391, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 436, 437, 438, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "live": [391, 441], "goe": [391, 396], "exactli": [391, 392, 409, 420, 437], "doesn": [391, 438, 441], "mani": [11, 146, 391, 407, 452], "think": 391, "project": [93, 391, 396], "ll": [391, 395, 396, 440], "carri": 391, "let": [391, 393, 396, 427, 436, 438, 440, 441], "super_mario_bro": [391, 436, 440], "pt": [391, 397], "level_util": 391, "md": 391, "As": [391, 396, 436, 441], "don": [391, 392, 394, 404, 441], "end": [391, 396, 427, 438], "ignor": 391, "altern": [146, 391, 407], "averag": 391, "abstract_black_box": 391, "abstract_problem_factori": 391, "problem_setup_inform": 438, "pythonpath": [], "runtim": 391, "imagin": [], "your_local_depend": [], "yourblackbox": [], "your_arg": 391, "your_second_arg": 391, "your_kwarg": 391, "yourproblemfactori": [], "chapter": [392, 393, 394, 396, 437, 438, 440], "your_problem": 391, "problem_info": [428, 440], "__name__": 391, "__main__": 391, "registri": 391, "register_problem": [], "your_problem_factori": [], "your_env": 391, "That": [391, 409], "camel_cas": 391, "under": [391, 393, 395, 406, 430], "tell": 391, "though": 391, "sai": [391, 396, 430, 436, 441], "channel": [391, 392], "machinelearninglifesci": [391, 392, 393, 394, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "dev": [391, 392, 393, 394, 396], "java": 391, "poli__mario": 391, "forg": 391, "pytorch": [391, 449], "openjdk": 391, "cpuonli": 391, "click": [391, 394, 399, 440], "moreov": [391, 392, 437, 455], "googl": [391, 394], "colab": [391, 394, 449], "put": [391, 396, 452], "describ": [11, 391, 396, 409, 440, 442, 443, 448, 449, 457], "register": [], "get_problem": [436, 440], "your_arg_1": 391, "mayb": 391, "your_arg_2": 391, "your_factori": 391, "thereof": [], "At": [21, 396, 438, 440], "point": [391, 392, 396, 438, 440, 444], "wrote": [], "direct": 451, "life": 397, "debug": [393, 428], "vscode": [], "available_problem_factori": 391, "importerror": [], "share": [391, 392, 393], "feel": [391, 392, 396], "contribut": [390, 391, 424, 440], "case": [392, 393, 396, 400, 428, 430, 433, 436, 437, 438, 440], "poli_baselin": [392, 393, 436, 440, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "almost": [392, 437], "trivial": [392, 393, 437, 440], "complic": [392, 437, 441], "likewis": [392, 437], "explain": [392, 437, 438], "abstractsolv": [392, 436, 437], "abstract_solv": [392, 436, 437], "black_box": [392, 393, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 436, 437, 438, 440, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "histori": [392, 436, 437, 449, 454, 456], "x0_i": 392, "y0_i": 392, "ingredi": [392, 396, 436, 437], "next_candid": [392, 436, 437], "propos": [146, 399, 407, 437, 440, 449, 455], "solv": [392, 427, 436, 437, 440, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "max_it": [392, 436, 437, 440, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "next": [392, 394, 396, 436, 437, 438, 440], "solut": [392, 407, 422, 437, 449, 452], "notimplementederror": [392, 437], "subclass": [391, 437], "100": [392, 437, 440, 452, 454, 456], "rang": [146, 392, 393, 407, 433, 437], "callback": [], "pre_step_callback": [], "turn": 455, "updat": [392, 436, 438, 440, 446, 449], "_": [391, 392, 393, 452], "post": [], "post_step_callback": [], "get_best_perform": 436, "break_at_perform": [], "break": [], "leverag": [392, 437], "fact": [392, 437], "simplest": [392, 436, 437], "random_mut": [392, 436, 437, 440], "len": [392, 437], "best_x": [392, 437], "argmax": [392, 437], "alwai": [392, 400, 430, 433, 437, 441], "next_x": [392, 437], "po": [392, 437], "randint": [392, 437], "choic": [392, 437, 452], "pretti": [392, 396, 437], "lean": [392, 437], "notic": [392, 420, 437, 438], "sort": [392, 428, 437, 452], "logic": [6, 391, 392, 437, 438, 441], "noth": [53, 392, 436, 437], "worri": [391, 392, 394, 437], "slightli": [392, 437], "unfortun": [393, 404], "linux": [393, 404, 441], "maco": [393, 404], "top": [393, 394, 440], "therefor": [393, 441], "anaconda": 393, "went": 393, "okai": [393, 397], "anoth": [393, 396, 436, 440, 449], "right": [391, 393, 438, 441], "bleed": 393, "edg": 393, "while": [128, 301, 393, 436], "stabl": [393, 436, 440], "releas": [393, 396], "shell": [391, 393], "home": [393, 395, 396, 409, 410, 411], "poli_object": [391, 393, 397], "phase": 393, "short": [393, 396], "futur": [393, 396], "everyth": [392, 393, 395, 438], "requisit": 393, "openbabel": [393, 404], "white_nois": [393, 433, 436, 440], "minimal_working_exampl": 393, "plenti": 393, "complex": [6, 390, 391, 392, 393, 396, 424], "rasp": [394, 397, 399, 436, 440], "pytdc": [], "accces": [], "featur": 397, "clash": [394, 396], "discuss": [438, 440], "baselin": [394, 436, 438, 440, 441, 442, 443, 444, 445, 448, 449, 452, 453, 455, 457], "place": [394, 395, 396], "fresh": 394, "full": [394, 396], "drawn": [394, 399], "unit": [394, 399], "word": [394, 399, 427], "spell": [394, 399], "3pbl": [394, 399, 406], "implmenet": [], "fluoresc": [394, 396, 399, 436], "On": 394, "focus": 394, "cma": 394, "es": 394, "vanilla": [390, 394], "acquisit": [394, 444, 451], "over": [390, 394, 453], "encourag": 455, "gonzalezduquebartelsmichael": [], "2024": [146, 390, 396, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "gonz\u00e1lez": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "duqu": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "bartel": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "simon": [390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "michael": [390, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "richard": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "month": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "jan": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "titl": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "libari": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "year": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "drd3_dock": [436, 440], "graff": [], "shakhnovich": [], "foldx_": [], "gfp_cba": [436, 440], "park": [], "listgarten": [], "gfp_select": [436, 440], "penalized_logp_lambo": [436, 440], "rdkit_": [], "rfp_foldx_": [], "sa_tdc": [436, 440], "ertl": [390, 424], "schuffenhau": [390, 424], "volz": [390, 427], "toy_continuous_problem": [393, 436, 440, 443], "2013": [390, 430], "coupl": [392, 394], "guid": [390, 394, 440, 449], "subset": [395, 430, 446], "suit": [13, 380, 391, 395], "thing": [391, 395, 396, 441], "dg": 395, "metric": [301, 395], "recent": 395, "academ": 395, "licens": 395, "zip": 395, "auxiliari": 395, "renam": [395, 396, 409, 410, 411], "help": 395, "mac": [395, 441], "warn": [395, 441], "unverifi": 395, "quarantin": 395, "command": [395, 396, 410, 411], "own": [6, 391, 392, 395], "risk": 395, "xattr": 395, "appl": 395, "familiar": 396, "ourselv": 396, "alreadi": [396, 436, 440], "refresh": 396, "essenti": [396, 438], "notebook": 396, "pathlib": [396, 397, 409, 410, 411, 436, 438], "shutil": 396, "path_to_foldx_fil": 396, "this_dir": [396, 438], "resolv": [396, 436, 438], "tmp": 396, "mkdir": [396, 438], "copyfil": 396, "respons": 396, "transport": 396, "oxigen": 396, "sperm": 396, "whale": 396, "101m": 396, "hand": 396, "urllib": 396, "web_address": 396, "rcsb": 396, "urlretriev": 396, "Of": [396, 440], "cours": [301, 396, 440], "long": [146, 396, 407, 436], "aid": [271, 274, 396], "pdb_name": 396, "choos": [396, 440], "repairpdb": [396, 410, 411], "littl": 396, "consumig": 396, "400sec": 396, "build": [396, 440, 444], "101m_repair": 396, "repair_cmd": 396, "water": [396, 410, 411, 422], "crystal": [396, 410, 411], "tree": 396, "fxout": 396, "unrecognized_molecul": 396, "onward": [396, 444], "inspect": 396, "parser": 396, "get_residu": 396, "dive": [6, 396, 440], "first_residu": 396, "resnam": 396, "index": 396, "get_par": 396, "met": 396, "extract": 396, "sequtil": 396, "seq1": 396, "original_residu": 396, "chain_id": 396, "position_in_sequ": 396, "mutant_residu": 396, "glycin": 396, "Be": [396, 397], "care": [396, 436, 441], "fire": 396, "did": 396, "modifi": [391, 396, 449], "mutation_list": 396, "residue_idx": 396, "li": [220, 229, 390, 396, 412, 415], "tranform": 396, "position_in_chain": 396, "content": [390, 396], "indiviual_list": 396, "ma0g": 396, "won": [396, 427], "buildmodel": 396, "gibb": 396, "foldx_cmd": 396, "consortium": 396, "jesper": [396, 409, 410, 411], "freder": [396, 409, 410, 411], "joost": [396, 409, 410, 411], "lui": [396, 409, 410, 411], "peter": [390, 396, 424], "vanhe": 396, "erik": [390, 396, 448], "verschueren": 396, "baeten": 396, "javier": 396, "delgado": 396, "francoi": [396, 409, 410, 411], "permut": 396, "concept": 396, "raphael": 396, "gueroi": 396, "backhbond": 396, "142": 396, "58": 396, "sidehbond": 396, "48": [137, 390, 396, 405], "61": 396, "energy_vdw": 396, "179": 396, "63": 396, "electro": 396, "energy_solvp": 396, "245": 396, "28": [396, 427], "energy_solvh": 396, "238": 396, "89": 396, "energy_vdwclash": 396, "42": 396, "energy_tors": 396, "70": 396, "backbone_vdwclash": 396, "158": 396, "entropy_sidec": 396, "105": 396, "87": 396, "entropy_mainc": 396, "231": 396, "69": 396, "bond": 396, "00": 396, "helix": 396, "dipol": 396, "75": 396, "loop_entropi": 396, "cis_bond": 396, "disulfid": 396, "kn": 396, "electrostat": 396, "partial": 396, "coval": 396, "energy_ionis": 396, "56": 396, "entropi": 396, "32": [390, 396, 457], "meta0": 396, "gly": 396, "ok": 396, "wed": 396, "feb": [396, 448], "44": 396, "52": 396, "spend": 396, "96": 396, "valid": 396, "101m_repair_1": 396, "successfulli": 396, "completedprocess": 396, "sjt972": [93, 396, 436, 440, 441], "understanding_foldx": 396, "01": [396, 415], "returncod": 396, "average_101m_repair": 396, "dif_101m_repair": 396, "pdblist_101m_repair": 396, "raw_101m_repair": 396, "wt_101m_repair_1": 396, "raw_": 396, "_repair": [396, 410, 411], "tabl": 396, "quantiti": 396, "column_nam": 396, "backbon": 396, "hbond": 396, "sidechain": 396, "van": 396, "der": 396, "waal": 396, "solvat": 396, "polar": 396, "hydrophob": 396, "mainchain": 396, "sloop_entropi": 396, "mloop_entropi": 396, "torsion": 396, "bridg": 396, "kon": 396, "ionis": 396, "pd": 396, "readlin": 396, "df": 396, "split": 396, "column": 396, "var": 396, "l3": 396, "qk9dx6g958765kmn_2wn34t00000gn": 396, "ipykernel_25734": 396, "1758354106": 396, "deprecationwarn": 396, "pyarrow": 396, "major": 396, "arrow": 396, "interoper": 396, "caus": 396, "pleas": [396, 436, 440, 441], "issu": [396, 409, 410, 411], "54466": 396, "overal": 396, "31": 396, "7457": 396, "34": [396, 413], "3436": 396, "notat": 396, "stand": [13, 396, 440], "again": 396, "wt_structur": 396, "mut_structur": 396, "pdb1": 396, "shrakeruplei": 396, "attach": [396, 438], "8407": 396, "731560227876": 396, "8439": 396, "063468009845": 396, "impact": 396, "databas": 396, "desir": [396, 440], "lesser": 396, "stabler": 396, "correl": 396, "present": [146, 396, 407], "supervis": 397, "approach": 397, "network": [390, 397, 427, 442, 443, 444, 448, 455, 457], "drawback": 397, "similar": [115, 128, 238, 394, 397, 399, 403, 425], "foldx_stabl": [397, 436, 440], "awar": [397, 444], "scale": [220, 229, 397, 430, 448], "easier": 397, "poli__rasp": 397, "correct": 428, "breakpoint": [], "satisfi": [], "root": 409, "3ned": [397, 436], "__file__": 397, "wildtype_pdb_paths_for_rasp": [], "f_rasp": [], "wildtype_str": [], "join": 436, "three": [438, 440], "three_mut": [], "wildtype_sequ": [], "ddg": [], "approx": [], "03": [390, 412, 427], "07": [], "clang": 397, "cmake": 397, "reduc": 397, "pin": 397, "hash": [390, 397, 442, 457], "bd23a0bf627ae9b08842102a5c2e9404b4a81924": 397, "cavity_model_15": 397, "ds_model": 397, "3ccebe87e017b6bd737f88e1943557d128c85616": 397, "against": [397, 404], "checksum": 397, "satur": 397, "mutagenesi": 397, "pmo": [13, 399, 405, 412, 415], "jump": [301, 399], "cap": 400, "prepar": 404, "autodock": 404, "vina": 404, "suppos": 404, "batteri": 404, "even": 404, "poli__dockstr": 441, "canon": 406, "risperidon": [404, 441], "dockstringproblemfactori": 404, "drd2": [137, 394, 399, 404, 441], "risperidone_smil": [], "cc1": [404, 441], "n2ccccc2": [404, 441], "n1": [404, 441], "ccn3ccc": [404, 441], "cc3": [398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 441], "c4": [404, 441], "noc5": [404, 441], "c4c": [404, 441], "c5": [404, 441], "handl": [392, 441], "hood": 406, "abov": [406, 409], "success": 406, "underneath": [409, 449], "poli__tdc": [], "text": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "foldx_rfp_lambo": [409, 436, 440], "poli__lambo": 409, "avali": 409, "skip": 409, "decid": 409, "11189": 409, "00587946": 409, "8155": 409, "acces": [410, 424], "foldx_stability_and_sasa": [410, 411, 436, 440], "v4": [410, 411], "filenam": [410, 411], "cach": [410, 411], "your_fil": [410, 411], "heteroatom": [410, 411], "pdbtool": [410, 411], "Then": [], "foldx_sasa": [436, 440], "poli__protein": 441, "carefulli": 420, "zinc": 420, "coeffici": 422, "octanol": 422, "rdkit_logp": [436, 440], "carbon": [420, 422, 423], "6361": 422, "rdkit_q": [436, 440, 445, 453], "35978494": [], "assert": [], "isclos": [], "8548": [], "run_info": 428, "link": 428, "peopl": [220, 229, 430], "sum_": 430, "x_d": 430, "saasbo": [394, 430], "assumpt": 430, "roughli": 430, "speak": 430, "question": [427, 430], "30d": 430, "dimensions_to_embed_in": [325, 328, 430], "mathcal": 433, "But": 435, "idea": 435, "rc": [], "sit": [], "rfp_foldx_stability_and_sasa": [436, 440], "stick": 436, "red": 436, "explor": [436, 444], "ls": 436, "3ned_repair": 436, "optimizing_protein_st": 436, "ipynb": 436, "mrogu": 436, "hopefulli": [], "remind": [], "forgot": [], "traceback": [], "138": [], "typeerror": [], "got": [], "unexpect": [], "176": [], "145": [], "cell": [], "439": [], "437": [], "438": [], "__create_as_isolated_process": [], "440": [], "441": [], "442": [], "443": [], "444": [], "445": [], "446": [], "447": [], "448": [], "449": [], "problem_inform": [], "451": [], "278": [], "tb": [], "msg": [], "277": [], "279": [], "280": [], "281": [], "msg_type": [], "282": [], "five": [], "section": 436, "select": [436, 451], "alter": 436, "special": [392, 436, 440], "n_iter": 436, "178": [], "76": [], "267": [], "80": [], "13": [], "374": [], "65": [], "17": [], "146": [], "340": [], "27": 390, "77": 441, "41": [], "na194f": [], "asna194": [], "193": [], "phe": [], "fri": [], "09": [], "51": [], "54": [271, 274], "3ned_repair_1": [], "qa114": [], "glna114": [], "113": [], "ser": [], "da3m": [], "aspa3": [], "kei": [393, 436], "get_best_solut": [436, 440, 452, 454, 456], "41639": [], "0629": [], "5983": [], "1298": [], "eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslsdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgemkmrlklkdgghydaevkttykakkpvqlpgayftntklditshnedytiveqyernegrhstggmdelyk": [], "appli": [437, 449], "part": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 427, 429, 431, 432, 434, 438, 440, 441], "compar": [394, 438, 441], "qualiti": 438, "save": 438, "json": 438, "mlflow": 438, "weight": 438, "bias": 438, "abstract_observ": 438, "skeleton": 438, "simpleobserv": 438, "init": 438, "servic": 438, "wandb": 438, "adjac": 438, "identifi": 438, "uuid4": 438, "metadata": 438, "uuid": 438, "experiment_path": 438, "as_dict": 438, "recal": 438, "tolist": 438, "dump": 438, "curiou": 438, "rememb": 438, "invent": 438, "wheel": 438, "tensorboard": 438, "fp": 438, "snippet": 438, "scenario": 438, "z": [220, 229, 438], "were": [146, 407, 438, 441], "accordingli": 438, "migu": 438, "flea": 438, "showcas": 438, "behind": 438, "saw": 438, "overwritten": 438, "deeper": [6, 440], "intro": 440, "treat": [115, 397, 440], "anyth": [], "further": [], "page": [390, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 440, 442, 451, 455], "randommut": [440, 454, 456], "anaconda3": [436, 440, 441], "docs2": [436, 440], "lib": [436, 440, 441], "python3": [436, 440, 441], "tqdm": [436, 440], "auto": [436, 440], "tqdmwarn": [436, 440], "iprogress": [436, 440], "jupyt": [436, 440], "ipywidget": [436, 440], "readthedoc": [436, 440], "io": [436, 440], "user_instal": [436, 440], "autonotebook": [436, 440], "notebook_tqdm": [436, 440], "16173153": [], "dtype": [], "u1": [], "talk": 440, "babel": 441, "No": [441, 455], "freez": 441, "grep": 441, "135": [], "dynamically_instanti": [], "102": [], "92": [], "exec": [], "modulenotfounderror": [], "critic": [], "opt": [], "homebrew": [], "condabin": [], "autodock_vina_1_1_2_mac_catalina_64bit": [], "usr": [], "cryptex": [], "app": [], "sbin": [], "cryptexd": [], "codex": [], "bootstrap": [], "appleintern": [], "tex": [], "texbin": [], "cargo": [], "using_poli": [], "the_bas": [], "python39": [], "dynload": [], "externalblackbox": [], "num_evalu": [], "dockstringwarn": 441, "although": 441, "perfectli": 441, "match": [392, 441], "platform": [424, 441], "report": [413, 414, 426, 434, 441], "f_logp": [], "x0_logp": [], "y0_logp": [], "logpblackbox": 422, "combin": [], "optimizing_aloha": [], "01_a_simple_example_of_optim": [], "our_aloha": [], "past": 391, "haven": [], "realli": [], "Its": [], "summari": [], "less": [], "conclud": [], "takeawai": [], "independ": [], "why": [], "registering_aloha": [], "search": 444, "aloof": [], "syntax": [], "ouralohablackbox": [], "sum": [], "axi": [390, 394], "keepdim": [], "get_max_sequence_length": [], "x_0": [], "alohablackbox": 400, "ascii_uppercas": [], "ouralohaproblemfactori": [], "interpret": [220, 229, 390, 412, 415], "poli_aloha": [], "poli_aloha_problem": [], "yourself": [], "aloha_problem_factori": [], "somewher": [], "workhors": [], "querying_aloha": [], "emphas": [], "amaz": [], "x1": [], "y1": [], "subtl": [], "cheminformat": [137, 220, 229, 390, 405, 412, 415, 422, 423, 424], "mechan": [], "solver": [442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "approxim": 444, "tild": 444, "boldsymbol": [444, 446], "surrog": 444, "render": [427, 444], "smartli": 444, "balanc": 444, "exploit": 444, "grid": 444, "vanillabayesianoptim": 444, "f_acklei": [442, 444, 448, 455, 457], "randn": [442, 444, 448, 451, 455, 457], "clip": [442, 444, 448, 451, 455, 457], "bo_solv": [442, 444, 448, 455, 457], "great": [390, 442, 443, 444, 448, 455, 457], "mostli": [442, 443, 444, 448, 455, 457], "intent": [442, 443, 444, 448, 455, 457], "adversari": [390, 427, 442, 443, 444, 448, 455, 457], "gan": [442, 443, 444, 448, 455, 457], "maintain": [6, 446], "mu": 446, "sigma": 446, "member": 446, "introduct": 446, "blogpost": 446, "pycma": 446, "cma_e": 446, "toycontinuousproblemfactori": 430, "population_s": [446, 451, 452], "initial_mean": 446, "initial_sigma": 446, "restrict": 451, "coordin": 451, "singletaskgp": 451, "type_of_lin": 451, "non": [146, 407, 452], "domin": 452, "mate": 452, "procedur": [390, 452], "upon": 452, "alohaproblemfactori": [392, 400, 452, 454, 456], "multi_objective_black_box": 452, "multiobjectiveblackbox": 452, "discretensgaii": 452, "hyperparamet": 452, "max_iter": 452, "num_mut": 452, "f_aloha": 452, "togeth": 452, "popul": [449, 452], "56267": [], "846902": [], "39441": [], "eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgemkmrlklkdgghydaevkttykakkpvqlpgayntntklditshnedytiveqyernegrhstggmdelyk": [], "258": [], "userwarn": [], "Will": [], "env_nam": [], "269": [], "compat": 6, "abstractisolatedfunct": [6, 391, 441], "externalfunct": 6, "external_isolated_function_script": 6, "properti": [11, 449], "fix": [11, 391, 407], "fidel": [21, 438], "noisi": 21, "etc": [21, 427], "black_box_inform": [391, 438], "blackboxinform": [26, 391, 433, 436, 438, 440], "abstractproblem": 109, "plan": [14, 142, 279, 427], "elbo": 210, "n_starting_point": 210, "playabl": 301, "checklist": 391, "pai": 391, "attent": 391, "my_problem_nam": 391, "desc": 391, "boilerpl": 391, "my_problem_inform": 391, "fixed_length": [391, 433, 438, 440], "determinist": [391, 433, 436, 438], "potenti": 391, "padding_token": [391, 433, 438], "entri": 391, "rout": 391, "whatev": 391, "one_depend": 391, "another_depend": 391, "yet_another_depend": 391, "complicatedclass": 391, "abstract_isolated_funct": 391, "myisolatedlog": 391, "register_isolated_funct": 391, "my_problem_name__isol": 391, "__isol": 391, "conda_env_inside_environment_fil": 391, "instance_function_as_isolated_process": 391, "my_problem_info": 391, "myblackbox": 391, "my_problem": [], "inner_funct": [391, 441], "weren": [], "problem_name__isol": [], "static": 391, "staticmethod": 391, "get_black_box_info": 391, "myproblemfactori": 391, "my_problem_factori": [], "available_black_box": [391, 393], "dict_kei": 393, "whitenoiseblackbox": [433, 440], "08390547": [], "properli": 436, "foldxstabilityproblemfactori": [411, 436], "foldxstabilityblackbox": [411, 436], "46959": 436, "4687": 436, "14886": 436, "56841": 436, "eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgimkmrlklkdgghydaevkttykakkpvqlpgayntntklditshnedytiveqyernegrhstggmdelyk": 436, "dockstringblackbox": [404, 441], "submodul": 441, "multiprocess": 441, "qedproblemfactori": 423, "qedblackbox": 423, "35978": 423, "toycontinuousblackbox": [430, 442, 444, 446, 448, 451, 455, 457], "whitenoiseproblemfactori": 433, "logpproblemfactori": 422, "drd3problemfactori": 406, "drd3blackbox": 406, "c1ccccc1": 406, "penalizedlogplamboproblemfactori": 420, "penalizedlogplamboblackbox": 420, "2238": 420, "saproblemfactori": 424, "sablackbox": 424, "ccnc": 424, "c1ccc": 424, "nc": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "n2cc": 424, "c2": 424, "c1": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "85483733": 424, "wildtype_repair": [410, 411], "foldxsasaproblemfactori": 410, "foldxsasablackbox": 410, "raspblackbox": 397, "raspproblemfactori": 397, "static_files_for_test": [], "ssmnonv16": 390, "jame": 390, "summervil": [390, 427], "sam": 390, "snodgrass": 390, "matea": 390, "onta": 390, "villar": 390, "vglc": 390, "video": 390, "game": [390, 427], "corpu": 390, "7th": 390, "workshop": 390, "tkb10": 390, "togeliu": [390, 427], "sergei": [390, 424, 427], "karakovskii": [390, 427], "robin": [390, 427], "baumgarten": [390, 427], "ai": [390, 427], "competit": [146, 390, 407, 427], "congress": [390, 427], "2010": [390, 427], "cec": [390, 427], "5586133": [390, 427], "classic": 427, "floor": 427, "pipe": [392, 427], "enemi": 427, "action": 427, "constrain": 427, "constraint": 427, "frame": 427, "buffer": 427, "screen": 427, "dropwdown": [], "hpc": 427, "cluster": [], "docker": 427, "xvfb": 427, "99": 427, "1024x768x24": 427, "extens": 427, "glx": 427, "noreset": 427, "background": 427, "marioai": 427, "supermariobrosblackbox": 427, "supermariobrosproblemfactori": 427, "visual": 427, "kha09": 390, "ahm": [390, 427], "khalifa": [390, 427], "amidos2006": [390, 427], "vl": 390, "vanessa": [390, 427], "luca": [390, 427], "schrum": [390, 427], "smith": [390, 427], "jialin": [390, 427], "liu": [220, 229, 390, 412, 415, 427], "sebastian": [390, 427], "risi": [390, 427], "evolv": [390, 427], "gecco": [390, 427], "221": [390, 427], "228": [390, 427], "1145": [390, 427], "3205455": [390, 427], "3205517": [390, 427], "extend": [13, 399], "guacamol": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 394, 398, 399, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "2206": 13, "12411": 13, "novo": [13, 115, 122, 125, 128, 137, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "59": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "pub": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341], "8b00839": [13, 115, 122, 125, 128, 149, 223, 226, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "tdcisolatedfunct": 15, "tdc__isol": 15, "albuterol": [115, 394, 399], "consist": [115, 125, 128, 238, 304, 331], "medicin": 115, "breath": 115, "difficulti": 115, "symptom": 115, "cite": [115, 122, 125, 128, 137, 149, 220, 223, 226, 229, 232, 235, 238, 241, 250, 253, 283, 286, 304, 331, 334, 341, 442, 443, 445, 448, 449, 451, 453, 455, 457], "amlodipin": [122, 394, 399], "mpo": [122, 149, 241, 250, 253, 286, 341, 394, 399], "celecoxib": [125, 394, 399], "rediscoveri": [125, 304, 331, 394, 399], "rediscov": [125, 304, 331], "decor": [128, 394, 399], "hop": [128, 283, 394, 399], "exclud": 128, "smart": [128, 334, 394, 399], "classifi": [137, 415], "olivecrona": [137, 390, 405], "bioactiv": 137, "dopamin": [137, 405], "receptor": [137, 405], "reinforc": [137, 390, 405], "jcheminf": 137, "biomedcentr": 137, "articl": [137, 397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 427, 429, 431, 432, 434, 448, 449], "1186": [137, 390, 405, 412, 415, 424], "s13321": [137, 390, 405, 412, 415], "017": [137, 390, 405], "0235": [137, 390, 405], "fexofenadin": [149, 394, 399], "glycogen": 220, "synthas": 220, "kinas": 220, "beta": 220, "gsk3beta": 220, "condit": [220, 229, 390, 392, 407, 412, 415], "graph": [220, 229, 390, 412, 415], "zhang": [220, 229, 390, 412, 415], "substructur": [220, 229, 390, 412, 415], "jin": [220, 229, 390, 412, 415], "wengong": [220, 229, 390, 412, 415], "regina": [220, 229, 390, 412, 415], "barzilai": [220, 229, 390, 412, 415], "tommi": [220, 229, 390, 412, 415], "jaakkola": [220, 229, 390, 412, 415], "icml": [220, 229], "csail": [220, 229], "mit": [220, 229], "jbj_icml2020b": [220, 229], "excap": [220, 229, 415], "db": [220, 229, 415], "integr": [220, 229], "larg": [220, 229], "facilit": [220, 229], "big": [220, 229], "analysi": [220, 229, 271, 274], "chemogenom": [220, 229], "jiangm": [220, 229], "isom": [223, 226, 394, 399], "c7h8n2o2": [223, 394, 399], "c9h10n2o2pf2cl": [226, 394, 399], "median": [232, 235, 394, 399], "mestranol": [238, 394, 399], "osimetrinib": [241, 394, 399], "perindopril": 250, "ranolazin": [253, 394, 399], "scaffold": [283, 394, 399], "sitagliptin": [286, 394, 399], "thiothixen": [304, 394, 399], "effect": [325, 442], "branin_2d": 328, "troglitazon": [331, 394, 399], "valsartan": [334, 394, 399], "zaleplon": [341, 394, 399], "famili": [398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 434], "albuterolsimilarityproblemfactori": 398, "albuterolsimilarityblackbox": 398, "1ccc2c": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "sc": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "coc3ccc": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "cl": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "c2c": [398, 401, 402, 403, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "2772277": 398, "resourc": [397, 398, 400, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "nathan": [390, 398, 401, 402, 403, 407, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434, 449], "marco": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "fiscato": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "marwin": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "segler": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "alain": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "vaucher": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "march": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1096": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "1108": [390, 398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "bibtex": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "issn": [397, 398, 401, 402, 403, 404, 405, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 427, 429, 431, 432, 434, 451, 455], "1549": [398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "9596": [398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "960x": [398, 401, 402, 403, 404, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "mar": [398, 401, 402, 403, 408, 413, 414, 416, 417, 418, 419, 421, 425, 426, 429, 431, 432, 434], "languag": [398, 401, 402, 403, 404, 405, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434, 443, 451, 455], "gonzalez": [397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434, 442, 443, 445, 448, 449, 451, 453, 455, 457], "forest": [405, 412, 415], "classif": [405, 412], "drd2problemfactori": 405, "drd2blackbox": 405, "001546": 405, "marcu": [390, 405], "thoma": [390, 405], "blaschk": [390, 405], "ola": [390, 405], "engkvist": [390, 405], "hongm": [390, 405, 424], "chen": [390, 405, 424], "septemb": [390, 405], "denovorl": 405, "1758": [390, 405, 412, 415, 424], "2946": [390, 405, 412, 415, 424], "bfsv19": 390, "obec17": 390, "yibo": [390, 412, 415], "liangren": [390, 412, 415], "zhenm": [390, 412, 415], "24": [390, 412, 415], "018": [390, 412, 415], "0287": [390, 412, 415], "37": [390, 412, 415], "th": [390, 412, 415], "119": [412, 415], "mocondit": [412, 415], "mointerpret": [412, 415], "jbj20": 390, "lzl18": 390, "gsk3\u03b2": [394, 399], "gsk3betaproblemfactori": 412, "gsk3betablackbox": 412, "es09": 390, "ansgar": [390, 424], "fragment": [390, 424], "june": [390, 424], "pzsl": 390, "miss": 390, "polykovskii": [390, 424], "mose": [390, 424], "daniil": 424, "alexand": 424, "zhebrak": 424, "sanchez": 424, "golovanov": 424, "oktai": 424, "tatanov": 424, "stanislav": 424, "belyaev": 424, "rauf": 424, "kurbanov": 424, "frontier": 424, "pharmacolog": 424, "frontiersin": 424, "3389": 424, "fphar": 424, "565644": 424, "jun": [405, 412, 424], "1663": 424, "9812": 424, "artamonov": 424, "aleksei": 424, "aladinskii": 424, "vladimir": 424, "veselov": 424, "mark": 424, "kadurin": 424, "artur": 424, "nikolenko": 424, "zhavoronkov": 424, "mestranolsimilarityproblemfactori": 418, "mestranolsimilarityblackbox": 418, "19460881": 418, "toward": [402, 413, 414, 416, 417, 429, 431], "celecoxibrediscoveryproblemfactori": 402, "celecoxibrediscoveryblackbox": 402, "14728682": 402, "thiothixenerediscoveryproblemfactori": 429, "thiothixenerediscoveryblackbox": 429, "17391304": 429, "troglitazonerediscoveryproblemfactori": 431, "troglitazonerediscoveryblackbox": 431, "24427481": 431, "properi": [401, 408, 419, 421, 426, 434], "respect": [401, 408, 419, 421, 426, 434], "amlodipinempoproblemfactori": 401, "amlodipinempoblackbox": 401, "46108397": 401, "fexofenadinempoproblemfactori": 408, "fexofenadinempoblackbox": 408, "43364462": 408, "osimetrinibmpoproblemfactori": 419, "osimetrinibmpoblackbox": 419, "09011743": 419, "ranolazinempoproblemfactori": 421, "ranolazinempoblackbox": 421, "29285467": 421, "discrep": [413, 414, 426, 434], "sitagliptinmpoproblemfactori": 426, "sitagliptinmpoblackbox": 426, "34970668e": 426, "zaleplonmpoproblemfactori": 434, "zaleplonmpoblackbox": 434, "0019018": 434, "deco": [394, 399], "decohopproblemfactori": 403, "decohopblackbox": 403, "53383654": 403, "scaffoldhopproblemfactori": 425, "scaffoldhopblackbox": 425, "38446411": 425, "formula": [413, 414], "isomerc7h8n2o2problemfactori": 413, "isomerc7h8n2o2blackbox": 413, "19875911e": 413, "isomerc9h10n2o2pf2clproblemfactori": 414, "isomerc9h10n2o2pf2clblackbox": 414, "71390843e": 414, "median1problemfactori": 416, "median1blackbox": 416, "09722244": 416, "median2problemfactori": 417, "median2blackbox": 417, "1225969": 417, "valsartansmartsproblemfactori": 432, "valsartansmartsblackbox": 432, "terapeut": 415, "jnk3": [394, 399, 415, 440], "jnk3problemfactori": 415, "jnk3blackbox": 415, "rdk06": 390, "2006": [390, 422, 423], "sb13": 390, "04": [390, 430], "2050": 397, "084x": 397, "publish": [397, 422, 423, 442, 448, 451, 455, 457], "public": 397, "ltd": 397, "garciaortegon": 404, "aug": 404, "robbi": [409, 410, 411], "88": [409, 410, 411], "1093": [409, 410, 411], "nar": [409, 410, 411], "gki387": [409, 410, 411], "0305": [409, 410, 411], "1048": [409, 410, 411], "12th": [422, 423, 427], "misc": [407, 422, 423, 427, 430, 445], "howpublish": [422, 423, 427, 430], "displai": 427, "pp": [427, 451], "marioaiframework": 427, "inproceed": [405, 412, 415, 427, 442, 443, 451, 453, 455, 457], "marioaicompetit": 427, "booktitl": [390, 427, 442, 451, 453, 457], "9781450356183": 427, "continuous_objective_benchmark": 430, "address": 430, "institut": 430, "surjanovicbingham": 430, "test_funct": 430, "hartmann_6d": 328, "rosenbrock": 328, "levi": 328, "threefold": 448, "prior": [394, 448, 455], "lengthscal": [394, 448, 455], "improv": [394, 448], "outputscal": 448, "bayesian_optim": [442, 443, 445, 448, 449, 453, 455, 457], "vanilla_bo_hvarfn": 448, "vanillabohvarfn": 448, "hvarfner": [390, 394], "hhn24": 390, "carl": [390, 448], "orm": [390, 448], "hellsten": [390, 448], "luigi": [390, 443, 445, 448], "nardi": [390, 443, 445, 448], "2402": [390, 448], "02229": [390, 448], "ej21": 390, "eriksson": [390, 394, 453, 455, 457], "martin": [390, 455], "jankowiak": [390, 394, 455], "spars": [390, 394], "cassio": 390, "campo": 390, "marlo": 390, "maathui": 390, "seventh": [390, 455], "161": 390, "493": [390, 455], "503": [390, 455], "v161": [390, 455], "eriksson21a": [390, 455], "ax": [394, 442, 448, 455], "saa": 455, "sparciti": 455, "fulli": 455, "treatment": 455, "nut": 455, "offici": [394, 445, 448, 449, 453], "noise_std": [443, 448], "48550": 448, "vanillabo": 448, "erikssonjankowiak": 455, "2640": [451, 455], "3498": [451, 455], "dec": 455, "lcrb20": 390, "roberto": [390, 442], "calandra": [390, 442], "akshara": [390, 442], "rai": [390, 442], "examin": [390, 442], "linear": 390, "1546": [390, 442], "1558": [390, 442], "10fb6cfa4c990d2bad5ddef4f70e8ba2": [390, 442], "lower_dim": 442, "dim": 442, "global": [390, 457], "6c990b7aca7bc7058f5e98ea909e924b": [390, 457], "pearc": [390, 457], "turner": [390, 457], "poloczek": [390, 443, 445, 457], "matthia": [390, 443, 445, 457], "epg": 390, "pnp22": 390, "papenmei": [390, 394, 443, 445], "baxu": [390, 394], "uniform": 443, "n_init": 443, "increas": 443, "scope": 443, "nest": 443, "e4wf6112di": 443, "leonard": [390, 443, 445], "expand": 394, "pnp24": 390, "bounc": [390, 394], "reliabl": [390, 445], "combinatori": [390, 394, 445], "mix": [390, 445, 453], "2307": [390, 445], "00618": [390, 445], "increasingli": [394, 445], "fork": [392, 445, 453], "bouncesolv": 445, "load_your_alphabet": 445, "sequence_length": [407, 445, 449, 453], "load_your_sequence_length": 445, "n_initial_point": [392, 445], "dwade": 390, "xingchen": [390, 453], "wan": [390, 453], "osborn": [390, 453], "probabilist": [390, 394], "reparameter": [390, 453], "35": [390, 453], "reparametr": 394, "probrep": [394, 453], "pr": [394, 453], "eprint": [407, 445], "archiveprefix": [407, 445], "primaryclass": [407, 445], "lg": [407, 445], "probabilisticreparametrizationsolv": 453, "load_alphabet": 453, "load_sequence_length": 453, "x0_": 453, "nop": 453, "impos": 392, "leav": 392, "x_i": 392, "y_i": 392, "reason": 392, "practition": 392, "quickli": 392, "stepbystepsolv": 392, "secondli": 392, "subfold": 392, "your_solver_nam": 392, "templat": 392, "poli__your_solver_nam": 392, "ideal": 392, "yoursolv": 392, "est": 392, "your_solv": 392, "poli__ax": [442, 448, 455], "poli__baxu": 443, "poli__bounc": 445, "poli__pr": 453, "NOT": 39, "prohibit": 40, "foldxstabilityandsasablackbox": [410, 411], "quick": [146, 407], "mind": [146, 407], "feasibl": [146, 407], "unfeas": [146, 407], "uninform": [146, 407], "motif": [146, 407], "within": [146, 407], "meant": [146, 397, 407], "alberstein": [146, 390, 407], "frei": [146, 390, 407, 449], "watkin": [146, 390, 407], "biophys": [146, 390, 407], "2407": [146, 390, 407], "00236": [146, 390, 407], "rough": [271, 274], "mount": [271, 274], "fuji": [271, 274], "rmf": [271, 274], "fit": [271, 274], "tunabl": [271, 274], "rugged": 271, "neidhart": [271, 274], "ig": 271, "szendro": [271, 274], "krug": [271, 274], "rug": [271, 274], "2014": [271, 274], "1534": [271, 274], "114": [271, 274], "167668": [271, 274], "aita": [271, 274], "mt": [271, 274], "prolyl": [271, 274], "endopeptidas": [271, 274], "thermolysin": [271, 274], "biopolym": [271, 274], "2000": [271, 274], "1002": [271, 274], "sici": [271, 274], "1097": [271, 274], "0282": [271, 274], "200007": [271, 274], "64": [271, 274], "bip70": [271, 274], "co": [271, 274], "na": 274, "198": 274, "699": 274, "721": 274, "uchiyama": 274, "iii": 371, "promis": 380, "fulfil": 407, "ehrlichblackbox": 407, "ehrlichproblemfactori": [407, 449], "256": 407, "motif_length": [407, 449], "n_motif": [407, 449], "quantiz": 407, "saf": 390, "robert": [390, 407], "ehrlich": [394, 440], "_only_": 407, "divis": 407, "processor": 407, "infinit": 407, "construct_optimal_solut": 407, "offset": 407, "construct_random_motif": 407, "construct_random_offset": 407, "iv": [], "albuterol_similar": 440, "amlodipine_mpo": 440, "celecoxib_rediscoveri": 440, "deco_hop": 440, "drd2_dock": 440, "fexofenadine_mpo": 440, "gsk3_beta": 440, "isomer_c7h8n2o2": 440, "isomer_c9h10n2o2pf2cl": 440, "median_1": 440, "median_2": 440, "mestranol_similar": 440, "osimetrinib_mpo": 440, "perindopril_mpo": 440, "ranolazine_mpo": 440, "rmf_landscap": 440, "scaffold_hop": 440, "sitagliptin_mpo": 440, "thiothixene_rediscoveri": 440, "troglitazone_rediscoveri": 440, "valsartan_smart": 440, "zaleplon_mpo": 440, "47139683": 440, "TO": 391, "get_inner_funct": 391, "isolated_function_nam": 391, "your_problem__isol": 391, "class_nam": 391, "module_to_import": 391, "other_kwargs_that_go_into_myisolatedlog": 391, "chains_to_keep": 397, "return_value_on_unfeas": [407, 449], "gsf": 390, "tim": [390, 449], "gj": [390, 449], "rudner": [390, 449], "isidro": [390, 449], "hotzel": [390, 449], "julien": [390, 449], "lafranc": [390, 449], "vanass": [390, 449], "arvind": [390, 449], "rajpal": [390, 449], "diffus": [390, 394, 449], "genentech": 449, "thermal": 449, "cortex": 449, "conserv": 449, "4th": 449, "lambo2": 394, "prescient": [], "alongsid": 449, "config_dir": 449, "config_nam": 449, "generic_train": 449, "max_epochs_for_retrain": 449, "param": [], "ensur": 449, "enough": 449, "reach": 449, "cfg": 449, "num_sampl": 449, "max_epoch": 449, "epoch": 449, "retrain": 449, "get_candidate_points_from_histori": 449, "offer": 394}, "objects": {"": [[0, 0, 0, "-", "poli"]], "poli": [[1, 0, 0, "-", "core"], [107, 0, 0, "-", "objective_factory"], [112, 0, 0, "-", "objective_repository"], [343, 0, 0, "-", "tests"]], "poli.core": [[2, 0, 0, "-", "abstract_benchmark"], [3, 0, 0, "-", "abstract_black_box"], [6, 0, 0, "-", "abstract_isolated_function"], [7, 0, 0, "-", "abstract_problem_factory"], [10, 0, 0, "-", "benchmark_information"], [11, 0, 0, "-", "black_box_information"], [12, 0, 0, "-", "chemistry"], [16, 0, 0, "-", "exceptions"], [19, 0, 0, "-", "multi_objective_black_box"], [21, 0, 0, "-", "problem"], [24, 0, 0, "-", "proteins"], [28, 0, 0, "-", "registry"], [37, 0, 0, "-", "util"]], "poli.core.abstract_black_box": [[4, 1, 1, "", "AbstractBlackBox"], [5, 1, 1, "", "NegativeBlackBox"]], "poli.core.abstract_black_box.AbstractBlackBox": [[4, 2, 1, "", "__call__"], [4, 2, 1, "", "__del__"], [4, 2, 1, "", "__enter__"], [4, 2, 1, "", "__exit__"], [4, 2, 1, "", "__init__"], [4, 2, 1, "", "__neg__"], [4, 2, 1, "", "_black_box"], [4, 3, 1, "", "batch_size"], [4, 3, 1, "", "num_workers"], [4, 3, 1, "", "observer"], [4, 3, 1, "", "observer_info"], [4, 3, 1, "", "parallelize"], [4, 2, 1, "", "reset_evaluation_budget"], [4, 2, 1, "", "set_observer"], [4, 2, 1, "", "terminate"]], "poli.core.abstract_black_box.NegativeBlackBox": [[5, 2, 1, "", "__init__"]], "poli.core.abstract_problem_factory": [[8, 1, 1, "", "AbstractProblemFactory"], [9, 1, 1, "", "MetaProblemFactory"]], "poli.core.abstract_problem_factory.AbstractProblemFactory": [[8, 2, 1, "", "__init__"]], "poli.core.abstract_problem_factory.MetaProblemFactory": [[9, 2, 1, "", "__init__"]], "poli.core.chemistry": [[13, 0, 0, "-", "tdc_black_box"], [15, 0, 0, "-", "tdc_isolated_function"]], "poli.core.chemistry.tdc_black_box": [[14, 1, 1, "", "TDCBlackBox"]], "poli.core.chemistry.tdc_black_box.TDCBlackBox": [[14, 2, 1, "", "__init__"], [14, 3, 1, "", "oracle_name"]], "poli.core.exceptions": [[17, 4, 1, "", "BudgetExhaustedException"], [18, 4, 1, "", "PoliException"]], "poli.core.multi_objective_black_box": [[20, 1, 1, "", "MultiObjectiveBlackBox"]], "poli.core.multi_objective_black_box.MultiObjectiveBlackBox": [[20, 2, 1, "", "__init__"], [20, 2, 1, "", "_black_box"], [20, 3, 1, "", "objective_functions"]], "poli.core.proteins": [[25, 0, 0, "-", "foldx_black_box"], [27, 0, 0, "-", "foldx_isolated_function"]], "poli.core.proteins.foldx_black_box": [[26, 1, 1, "", "FoldxBlackBox"]], "poli.core.proteins.foldx_black_box.FoldxBlackBox": [[26, 2, 1, "", "__init__"], [26, 2, 1, "", "create_working_directory"], [26, 3, 1, "", "experiment_id"], [26, 3, 1, "", "tmp_folder"], [26, 3, 1, "", "wildtype_amino_acids"], [26, 3, 1, "", "wildtype_pdb_paths"], [26, 3, 1, "", "wildtype_residue_strings"], [26, 3, 1, "", "wildtype_residues"]], "poli.core.util": [[38, 0, 0, "-", "abstract_observer"], [40, 0, 0, "-", "algorithm_observer_wrapper"], [41, 0, 0, "-", "alignment"], [43, 0, 0, "-", "batch"], [46, 0, 0, "-", "chemistry"], [53, 0, 0, "-", "default_observer"], [54, 0, 0, "-", "external_observer"], [56, 0, 0, "-", "files"], [62, 0, 0, "-", "inter_process_communication"], [66, 0, 0, "-", "isolation"], [72, 0, 0, "-", "objective_management"], [76, 0, 0, "-", "observer_wrapper"], [78, 0, 0, "-", "proteins"], [99, 0, 0, "-", "seeding"]], "poli.core.util.abstract_observer": [[39, 1, 1, "", "AbstractObserver"]], "poli.core.util.abstract_observer.AbstractObserver": [[39, 2, 1, "", "__init__"], [39, 2, 1, "", "finish"], [39, 2, 1, "", "initialize_observer"], [39, 2, 1, "", "observe"]], "poli.core.util.alignment": [[42, 0, 0, "-", "is_aligned"]], "poli.core.util.batch": [[44, 0, 0, "-", "batch_input"]], "poli.core.util.batch.batch_input": [[45, 5, 1, "", "batched"]], "poli.core.util.chemistry": [[47, 0, 0, "-", "string_to_molecule"]], "poli.core.util.chemistry.string_to_molecule": [[48, 5, 1, "", "selfies_to_molecules"], [49, 5, 1, "", "smiles_to_molecules"], [50, 5, 1, "", "strings_to_molecules"], [51, 5, 1, "", "translate_selfies_to_smiles"], [52, 5, 1, "", "translate_smiles_to_selfies"]], "poli.core.util.external_observer": [[55, 1, 1, "", "ExternalObserver"]], "poli.core.util.external_observer.ExternalObserver": [[55, 2, 1, "", "__getattr__"], [55, 2, 1, "", "__init__"], [55, 2, 1, "", "finish"], [55, 2, 1, "", "initialize_observer"], [55, 2, 1, "", "observe"]], "poli.core.util.files": [[57, 0, 0, "-", "download_files_from_github"], [60, 0, 0, "-", "integrity"]], "poli.core.util.files.download_files_from_github": [[58, 5, 1, "", "download_file_from_github_repository"], [59, 5, 1, "", "get_sha_for_tag"]], "poli.core.util.files.integrity": [[61, 5, 1, "", "compute_md5_from_filepath"]], "poli.core.util.inter_process_communication": [[63, 0, 0, "-", "process_wrapper"]], "poli.core.util.inter_process_communication.process_wrapper": [[64, 1, 1, "", "ProcessWrapper"], [65, 5, 1, "", "get_connection"]], "poli.core.util.inter_process_communication.process_wrapper.ProcessWrapper": [[64, 2, 1, "", "__init__"]], "poli.core.util.isolation": [[68, 0, 0, "-", "external_function"], [69, 0, 0, "-", "instancing"], [70, 0, 0, "-", "isolated_black_box"]], "poli.core.util.objective_management": [[73, 0, 0, "-", "make_run_script"]], "poli.core.util.objective_management.make_run_script": [[74, 5, 1, "", "make_observer_script"]], "poli.core.util.observer_wrapper": [[77, 5, 1, "", "start_observer_process"]], "poli.core.util.proteins": [[79, 0, 0, "-", "defaults"], [80, 0, 0, "-", "foldx"], [82, 0, 0, "-", "mutations"], [86, 0, 0, "-", "pdb_parsing"], [90, 0, 0, "-", "rasp"]], "poli.core.util.proteins.foldx": [[81, 1, 1, "", "FoldxInterface"]], "poli.core.util.proteins.foldx.FoldxInterface": [[81, 2, 1, "", "__init__"], [81, 2, 1, "", "_compute_sasa"], [81, 2, 1, "", "_read_energy"], [81, 2, 1, "", "_repair_if_necessary_and_provide_path"], [81, 2, 1, "", "_simulate_mutations"], [81, 2, 1, "", "compute_sasa"], [81, 2, 1, "", "compute_stability"], [81, 2, 1, "", "compute_stability_and_sasa"], [81, 2, 1, "", "copy_foldx_files"], [81, 2, 1, "", "repair"], [81, 3, 1, "", "verbose"], [81, 3, 1, "", "working_dir"], [81, 2, 1, "", "write_mutations_to_file"]], "poli.core.util.proteins.mutations": [[83, 5, 1, "", "edits_between_strings"], [84, 5, 1, "", "find_closest_wildtype_pdb_file_to_mutant"], [85, 5, 1, "", "mutations_from_wildtype_residues_and_mutant"]], "poli.core.util.proteins.pdb_parsing": [[87, 5, 1, "", "parse_pdb_as_residue_strings"], [88, 5, 1, "", "parse_pdb_as_residues"], [89, 5, 1, "", "parse_pdb_as_structure"]], "poli.core.util.proteins.rasp": [[91, 0, 0, "-", "inner_rasp"], [97, 6, 1, "", "load_models"], [98, 6, 1, "", "rasp_interface"]], "poli.core.util.proteins.rasp.inner_rasp": [[92, 6, 1, "", "PrismData"], [93, 6, 1, "", "cavity_model"]], "poli.core.util.seeding": [[100, 0, 0, "-", "seeding"]], "poli.core.util.seeding.seeding": [[101, 5, 1, "", "seed_numpy"], [102, 5, 1, "", "seed_python"]], "poli.objective_factory": [[109, 5, 1, "", "create"], [110, 5, 1, "", "load_config"], [111, 5, 1, "", "start"]], "poli.objective_repository": [[113, 0, 0, "-", "albuterol_similarity"], [116, 0, 0, "-", "aloha"], [120, 0, 0, "-", "amlodipine_mpo"], [123, 0, 0, "-", "celecoxib_rediscovery"], [126, 0, 0, "-", "deco_hop"], [129, 0, 0, "-", "dockstring"], [135, 0, 0, "-", "drd2_docking"], [138, 0, 0, "-", "drd3_docking"], [144, 0, 0, "-", "ehrlich"], [147, 0, 0, "-", "fexofenadine_mpo"], [150, 0, 0, "-", "foldx_rfp_lambo"], [158, 0, 0, "-", "foldx_sasa"], [165, 0, 0, "-", "foldx_stability"], [172, 0, 0, "-", "foldx_stability_and_sasa"], [178, 0, 0, "-", "gfp_cbas"], [212, 0, 0, "-", "gfp_select"], [218, 0, 0, "-", "gsk3_beta"], [221, 0, 0, "-", "isomer_c7h8n2o2"], [224, 0, 0, "-", "isomer_c9h10n2o2pf2cl"], [227, 0, 0, "-", "jnk3"], [230, 0, 0, "-", "median_1"], [233, 0, 0, "-", "median_2"], [236, 0, 0, "-", "mestranol_similarity"], [239, 0, 0, "-", "osimetrinib_mpo"], [242, 0, 0, "-", "penalized_logp_lambo"], [248, 0, 0, "-", "perindopril_mpo"], [251, 0, 0, "-", "ranolazine_mpo"], [254, 0, 0, "-", "rasp"], [258, 0, 0, "-", "rdkit_logp"], [263, 0, 0, "-", "rdkit_qed"], [268, 0, 0, "-", "rfp_foldx_stability_and_sasa"], [271, 0, 0, "-", "rmf_landscape"], [275, 0, 0, "-", "sa_tdc"], [281, 0, 0, "-", "scaffold_hop"], [284, 0, 0, "-", "sitagliptin_mpo"], [287, 0, 0, "-", "super_mario_bros"], [302, 0, 0, "-", "thiothixene_rediscovery"], [305, 0, 0, "-", "toy_continuous_problem"], [329, 0, 0, "-", "troglitazone_rediscovery"], [332, 0, 0, "-", "valsartan_smarts"], [335, 0, 0, "-", "white_noise"], [339, 0, 0, "-", "zaleplon_mpo"]], "poli.objective_repository.albuterol_similarity": [[115, 0, 0, "-", "register"]], "poli.objective_repository.aloha": [[117, 0, 0, "-", "register"]], "poli.objective_repository.aloha.register": [[118, 1, 1, "", "AlohaBlackBox"], [119, 1, 1, "", "AlohaProblemFactory"]], "poli.objective_repository.aloha.register.AlohaBlackBox": [[118, 2, 1, "", "__init__"], [118, 2, 1, "", "_black_box"], [118, 3, 1, "", "alphabet"]], "poli.objective_repository.aloha.register.AlohaProblemFactory": [[119, 2, 1, "", "__init__"], [119, 2, 1, "", "create"]], "poli.objective_repository.amlodipine_mpo": [[122, 0, 0, "-", "register"]], "poli.objective_repository.celecoxib_rediscovery": [[125, 0, 0, "-", "register"]], "poli.objective_repository.deco_hop": [[128, 0, 0, "-", "register"]], "poli.objective_repository.dockstring": [[131, 0, 0, "-", "isolated_function"], [132, 0, 0, "-", "register"]], "poli.objective_repository.dockstring.register": [[133, 1, 1, "", "DockstringBlackBox"], [134, 1, 1, "", "DockstringProblemFactory"]], "poli.objective_repository.dockstring.register.DockstringBlackBox": [[133, 2, 1, "", "__init__"], [133, 2, 1, "", "_black_box"], [133, 3, 1, "", "alphabet"]], "poli.objective_repository.dockstring.register.DockstringProblemFactory": [[134, 2, 1, "", "__init__"], [134, 2, 1, "", "create"]], "poli.objective_repository.drd2_docking": [[137, 0, 0, "-", "register"]], "poli.objective_repository.drd3_docking": [[141, 0, 0, "-", "register"]], "poli.objective_repository.drd3_docking.register": [[142, 1, 1, "", "DRD3BlackBox"], [143, 1, 1, "", "DRD3ProblemFactory"]], "poli.objective_repository.drd3_docking.register.DRD3BlackBox": [[142, 2, 1, "id0", "__init__"], [142, 3, 1, "", "oracle_name"]], "poli.objective_repository.drd3_docking.register.DRD3ProblemFactory": [[143, 2, 1, "", "__init__"]], "poli.objective_repository.ehrlich": [[146, 0, 0, "-", "register"]], "poli.objective_repository.ehrlich.register": [[407, 1, 1, "", "EhrlichBlackBox"], [407, 1, 1, "", "EhrlichProblemFactory"]], "poli.objective_repository.ehrlich.register.EhrlichBlackBox": [[407, 2, 1, "", "construct_optimal_solution"], [407, 2, 1, "", "construct_random_motifs"], [407, 2, 1, "", "construct_random_offsets"]], "poli.objective_repository.ehrlich.register.EhrlichProblemFactory": [[407, 2, 1, "", "create"]], "poli.objective_repository.fexofenadine_mpo": [[149, 0, 0, "-", "register"]], "poli.objective_repository.foldx_rfp_lambo": [[151, 0, 0, "-", "information"], [152, 0, 0, "-", "isolated_function"], [153, 0, 0, "-", "register"]], "poli.objective_repository.foldx_sasa": [[161, 0, 0, "-", "isolated_function"], [162, 0, 0, "-", "register"]], "poli.objective_repository.foldx_sasa.register": [[163, 1, 1, "", "FoldXSASABlackBox"], [164, 1, 1, "", "FoldXSASAProblemFactory"]], "poli.objective_repository.foldx_sasa.register.FoldXSASABlackBox": [[163, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_sasa.register.FoldXSASAProblemFactory": [[164, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_stability": [[168, 0, 0, "-", "isolated_function"], [169, 0, 0, "-", "register"]], "poli.objective_repository.foldx_stability.register": [[170, 1, 1, "", "FoldXStabilityBlackBox"], [171, 1, 1, "", "FoldXStabilityProblemFactory"]], "poli.objective_repository.foldx_stability.register.FoldXStabilityBlackBox": [[170, 2, 1, "", "__init__"], [170, 2, 1, "", "_black_box"]], "poli.objective_repository.foldx_stability.register.FoldXStabilityProblemFactory": [[171, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_stability_and_sasa": [[174, 0, 0, "-", "isolated_function"], [175, 0, 0, "-", "register"]], "poli.objective_repository.foldx_stability_and_sasa.register": [[176, 1, 1, "", "FoldXStabilityAndSASABlackBox"], [177, 1, 1, "", "FoldXStabilityAndSASAProblemFactory"]], "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASABlackBox": [[176, 2, 1, "", "__init__"]], "poli.objective_repository.foldx_stability_and_sasa.register.FoldXStabilityAndSASAProblemFactory": [[177, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas": [[179, 0, 0, "-", "abstract_vae_wrapper"], [181, 0, 0, "-", "cbas_alphabet_preprocessing"], [196, 0, 0, "-", "cbas_wrapper"], [200, 0, 0, "-", "gfp_gp"], [201, 0, 0, "-", "information"], [202, 0, 0, "-", "isolated_function"], [203, 0, 0, "-", "make_vae"], [209, 0, 0, "-", "register"]], "poli.objective_repository.gfp_cbas.abstract_vae_wrapper": [[180, 1, 1, "", "AbstractVAEWrapper"]], "poli.objective_repository.gfp_cbas.abstract_vae_wrapper.AbstractVAEWrapper": [[180, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.cbas_alphabet_preprocessing": [[182, 5, 1, "", "convert_aas_to_idx_array"], [183, 5, 1, "", "convert_idx_array_to_aas"], [184, 5, 1, "", "convert_mutations_to_sequence"], [185, 5, 1, "", "get_argmax"], [186, 5, 1, "", "get_balaji_predictions"], [187, 5, 1, "", "get_experimental_X_y"], [188, 5, 1, "", "get_gfp_X_y_aa"], [189, 5, 1, "", "get_gfp_base_seq"], [190, 5, 1, "", "get_samples"], [191, 5, 1, "", "one_hot_encode_aa"], [192, 5, 1, "", "one_hot_encode_aa_array"], [193, 5, 1, "", "one_hot_encode_dna"], [194, 5, 1, "", "partition_data"], [195, 5, 1, "", "read_gfp_data"]], "poli.objective_repository.gfp_cbas.cbas_wrapper": [[197, 1, 1, "", "CBASVAEWrapper"], [198, 1, 1, "", "ConvertedTorchVaeDecoder"], [199, 1, 1, "", "ConvertedTorchVaeEncoder"]], "poli.objective_repository.gfp_cbas.cbas_wrapper.CBASVAEWrapper": [[197, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeDecoder": [[198, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.cbas_wrapper.ConvertedTorchVaeEncoder": [[199, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.make_vae": [[204, 1, 1, "", "BaseVAE"], [205, 1, 1, "", "SimpleVAE"], [206, 5, 1, "", "build_vae"], [207, 5, 1, "", "identity_loss"], [208, 5, 1, "", "summed_categorical_crossentropy"]], "poli.objective_repository.gfp_cbas.make_vae.BaseVAE": [[204, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.make_vae.SimpleVAE": [[205, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.register": [[210, 1, 1, "", "GFPCBasBlackBox"], [211, 1, 1, "", "GFPCBasProblemFactory"]], "poli.objective_repository.gfp_cbas.register.GFPCBasBlackBox": [[210, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_cbas.register.GFPCBasProblemFactory": [[211, 2, 1, "", "__init__"]], "poli.objective_repository.gfp_select": [[213, 0, 0, "-", "information"], [214, 0, 0, "-", "isolated_function"], [215, 0, 0, "-", "register"]], "poli.objective_repository.gfp_select.register": [[217, 1, 1, "", "GFPSelectionProblemFactory"]], "poli.objective_repository.gfp_select.register.GFPSelectionProblemFactory": [[217, 2, 1, "", "__init__"]], "poli.objective_repository.gsk3_beta": [[220, 0, 0, "-", "register"]], "poli.objective_repository.isomer_c7h8n2o2": [[223, 0, 0, "-", "register"]], "poli.objective_repository.isomer_c9h10n2o2pf2cl": [[226, 0, 0, "-", "register"]], "poli.objective_repository.jnk3": [[229, 0, 0, "-", "register"]], "poli.objective_repository.median_1": [[232, 0, 0, "-", "register"]], "poli.objective_repository.median_2": [[235, 0, 0, "-", "register"]], "poli.objective_repository.mestranol_similarity": [[238, 0, 0, "-", "register"]], "poli.objective_repository.osimetrinib_mpo": [[241, 0, 0, "-", "register"]], "poli.objective_repository.penalized_logp_lambo": [[244, 0, 0, "-", "isolated_function"], [245, 0, 0, "-", "register"]], "poli.objective_repository.penalized_logp_lambo.register": [[246, 1, 1, "", "PenalizedLogPLamboBlackBox"], [247, 1, 1, "", "PenalizedLogPLamboProblemFactory"]], "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboBlackBox": [[246, 2, 1, "", "__init__"]], "poli.objective_repository.penalized_logp_lambo.register.PenalizedLogPLamboProblemFactory": [[247, 2, 1, "", "__init__"]], "poli.objective_repository.perindopril_mpo": [[250, 0, 0, "-", "register"]], "poli.objective_repository.ranolazine_mpo": [[253, 0, 0, "-", "register"]], "poli.objective_repository.rasp": [[256, 0, 0, "-", "isolated_function"], [257, 0, 0, "-", "register"]], "poli.objective_repository.rdkit_logp": [[260, 0, 0, "-", "register"]], "poli.objective_repository.rdkit_logp.register": [[261, 1, 1, "", "LogPBlackBox"], [262, 1, 1, "", "LogPProblemFactory"]], "poli.objective_repository.rdkit_logp.register.LogPBlackBox": [[261, 2, 1, "", "__init__"], [261, 2, 1, "", "_black_box"], [261, 3, 1, "", "from_selfies"], [261, 3, 1, "", "from_smiles"]], "poli.objective_repository.rdkit_logp.register.LogPProblemFactory": [[262, 2, 1, "", "__init__"]], "poli.objective_repository.rdkit_qed": [[265, 0, 0, "-", "register"]], "poli.objective_repository.rdkit_qed.register": [[266, 1, 1, "", "QEDBlackBox"], [267, 1, 1, "", "QEDProblemFactory"]], "poli.objective_repository.rdkit_qed.register.QEDBlackBox": [[266, 2, 1, "", "__init__"], [266, 2, 1, "", "_black_box"], [266, 3, 1, "", "from_selfies"], [266, 3, 1, "", "from_smiles"]], "poli.objective_repository.rdkit_qed.register.QEDProblemFactory": [[267, 2, 1, "", "__init__"], [267, 2, 1, "", "create"]], "poli.objective_repository.rfp_foldx_stability_and_sasa": [[270, 0, 0, "-", "register"]], "poli.objective_repository.rmf_landscape": [[273, 0, 0, "-", "isolated_function"], [274, 0, 0, "-", "register"]], "poli.objective_repository.sa_tdc": [[276, 0, 0, "-", "information"], [277, 0, 0, "-", "isolated_function"], [278, 0, 0, "-", "register"]], "poli.objective_repository.sa_tdc.register": [[279, 1, 1, "", "SABlackBox"], [280, 1, 1, "", "SAProblemFactory"]], "poli.objective_repository.sa_tdc.register.SABlackBox": [[279, 2, 1, "", "__init__"]], "poli.objective_repository.sa_tdc.register.SAProblemFactory": [[280, 2, 1, "", "__init__"], [280, 2, 1, "", "create"]], "poli.objective_repository.scaffold_hop": [[282, 0, 0, "-", "information"], [283, 0, 0, "-", "register"]], "poli.objective_repository.sitagliptin_mpo": [[285, 0, 0, "-", "information"], [286, 0, 0, "-", "register"]], "poli.objective_repository.super_mario_bros": [[288, 0, 0, "-", "information"], [289, 0, 0, "-", "level_utils"], [301, 0, 0, "-", "register"]], "poli.objective_repository.super_mario_bros.level_utils": [[290, 5, 1, "", "add_padding_to_level"], [291, 5, 1, "", "clean_level"], [292, 5, 1, "", "level_to_array"], [293, 5, 1, "", "level_to_list"], [294, 5, 1, "", "levels_to_onehot"], [295, 5, 1, "", "onehot_to_levels"], [297, 5, 1, "", "vectorized"]], "poli.objective_repository.thiothixene_rediscovery": [[304, 0, 0, "-", "register"]], "poli.objective_repository.toy_continuous_problem": [[306, 0, 0, "-", "definitions"], [324, 0, 0, "-", "register"], [327, 0, 0, "-", "toy_continuous_problem"]], "poli.objective_repository.toy_continuous_problem.definitions": [[307, 5, 1, "", "ackley_function_01"], [308, 5, 1, "", "alpine_01"], [309, 5, 1, "", "alpine_02"], [310, 5, 1, "", "bent_cigar"], [311, 5, 1, "", "brown"], [312, 5, 1, "", "camelback_2d"], [313, 5, 1, "", "chung_reynolds"], [314, 5, 1, "", "cosine_mixture"], [315, 5, 1, "", "cross_in_tray"], [316, 5, 1, "", "deb_01"], [317, 5, 1, "", "deb_02"], [318, 5, 1, "", "deflected_corrugated_spring"], [319, 5, 1, "", "easom"], [320, 5, 1, "", "egg_holder"], [321, 5, 1, "", "shifted_sphere"], [322, 5, 1, "", "styblinski_tang"]], "poli.objective_repository.toy_continuous_problem.register": [[325, 1, 1, "", "ToyContinuousBlackBox"], [326, 1, 1, "", "ToyContinuousProblemFactory"]], "poli.objective_repository.toy_continuous_problem.register.ToyContinuousBlackBox": [[325, 2, 1, "", "__init__"], [325, 2, 1, "", "_black_box"], [325, 3, 1, "", "bounds"], [325, 3, 1, "", "embed_in"], [325, 3, 1, "", "function"], [325, 3, 1, "", "function_name"], [325, 3, 1, "", "n_dimensions"]], "poli.objective_repository.toy_continuous_problem.register.ToyContinuousProblemFactory": [[326, 2, 1, "", "__init__"]], "poli.objective_repository.toy_continuous_problem.toy_continuous_problem": [[328, 1, 1, "", "ToyContinuousProblem"]], "poli.objective_repository.toy_continuous_problem.toy_continuous_problem.ToyContinuousProblem": [[328, 2, 1, "", "__init__"]], "poli.objective_repository.troglitazone_rediscovery": [[331, 0, 0, "-", "register"]], "poli.objective_repository.valsartan_smarts": [[334, 0, 0, "-", "register"]], "poli.objective_repository.white_noise": [[336, 0, 0, "-", "register"]], "poli.objective_repository.white_noise.register": [[337, 1, 1, "", "WhiteNoiseBlackBox"], [338, 1, 1, "", "WhiteNoiseProblemFactory"]], "poli.objective_repository.white_noise.register.WhiteNoiseBlackBox": [[337, 2, 1, "", "__init__"], [337, 2, 1, "", "_black_box"]], "poli.objective_repository.white_noise.register.WhiteNoiseProblemFactory": [[338, 2, 1, "", "__init__"]], "poli.objective_repository.zaleplon_mpo": [[341, 0, 0, "-", "register"]], "poli.tests": [[344, 0, 0, "-", "benchmarks"], [346, 0, 0, "-", "conftest"], [347, 0, 0, "-", "docs_examples"], [355, 0, 0, "-", "information"], [357, 0, 0, "-", "registry"], [380, 0, 0, "-", "test_core_promises"], [383, 0, 0, "-", "test_seeding"], [385, 0, 0, "-", "util"]], "poli.tests.information": [[356, 0, 0, "-", "test_dynamic_information"]], "poli.tests.registry": [[358, 0, 0, "-", "basic_objectives"], [363, 0, 0, "-", "chemistry"], [365, 0, 0, "-", "proteins"], [369, 0, 0, "-", "test_basic_loop_without_create"], [371, 0, 0, "-", "test_force_isolation"], [373, 0, 0, "-", "test_multi_objective_and_negative"], [375, 0, 0, "-", "toy_continuous_problems"], [379, 0, 0, "-", "toy_discrete_problems"]], "poli.tests.registry.basic_objectives": [[359, 0, 0, "-", "test_basic_objectives"]], "poli.tests.registry.basic_objectives.test_basic_objectives": [[360, 5, 1, "", "test_registering_aloha"], [361, 5, 1, "", "test_registering_white_noise"]], "poli.tests.registry.toy_continuous_problems": [[376, 0, 0, "-", "test_embedding_problems_into_higher_dims"]], "poli.tests.registry.toy_continuous_problems.test_embedding_problems_into_higher_dims": [[377, 5, 1, "", "test_embed_camelback_into_high_dimensions"]], "poli_baselines.solvers.bayesian_optimization.lambo2": [[449, 1, 1, "", "LaMBO2"]], "poli_baselines.solvers.bayesian_optimization.lambo2.LaMBO2": [[449, 2, 1, "", "get_candidate_points_from_history"], [449, 7, 1, "", "history"], [449, 2, 1, "", "solve"], [449, 2, 1, "", "step"]]}, "objtypes": {"0": "py:module", "1": "py:class", "2": "py:method", "3": "py:attribute", "4": "py:exception", "5": "py:function", "6": "py:data", "7": "py:property"}, "objnames": {"0": ["py", "module", "Python module"], "1": ["py", "class", "Python class"], "2": ["py", "method", "Python method"], "3": ["py", "attribute", "Python attribute"], "4": ["py", "exception", "Python exception"], "5": ["py", "function", "Python function"], "6": ["py", "data", "Python data"], "7": ["py", "property", "Python property"]}, "titleterms": {"poli": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 389, 392, 393, 394, 439, 440], "core": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 438], "abstract_black_box": [3, 4, 5], "abstractblackbox": 4, "negativeblackbox": 5, "abstract_problem_factori": [7, 8, 9], "abstractproblemfactori": 8, "metaproblemfactori": 9, "chemistri": [12, 13, 14, 15, 46, 47, 48, 49, 50, 51, 52, 363, 364], "tdc_black_box": [13, 14], "tdcblackbox": 14, "except": [16, 17, 18], "budgetexhaustedexcept": 17, "poliexcept": 18, "multi_objective_black_box": [19, 20], "multiobjectiveblackbox": 20, "problem_setup_inform": [22, 23], "problemsetupinform": 23, "protein": [24, 25, 26, 27, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 365, 366, 367, 368, 394, 396, 399, 409, 410, 411, 436], "foldx_black_box": [25, 26], "foldxblackbox": 26, "registri": [28, 29, 30, 31, 32, 33, 34, 35, 36, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379], "delete_observer_run_script": 29, "delete_problem": 30, "get_problem_factori": 31, "get_problem": 32, "register_problem": 33, "register_problem_from_repositori": 34, "set_observ": 35, "set_observer_run_script": 36, "util": [37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 385, 386, 387], "abstract_observ": [38, 39], "abstractobserv": 39, "align": [41, 42, 455], "is_align": 42, "batch": [43, 44, 45, 437], "batch_input": [44, 45], "string_to_molecul": [47, 48, 49, 50, 51, 52], "selfies_to_molecul": 48, "smiles_to_molecul": 49, "strings_to_molecul": 50, "translate_selfies_to_smil": 51, "translate_smiles_to_selfi": 52, "external_observ": [54, 55], "externalobserv": 55, "file": [56, 57, 58, 59, 60, 61, 396, 406, 410, 411], "download_files_from_github": [57, 58, 59], "download_file_from_github_repositori": 58, "get_sha_for_tag": 59, "integr": [60, 61], "compute_md5_from_filepath": 61, "inter_process_commun": [62, 63, 64, 65], "process_wrapp": [63, 64, 65], "processwrapp": 64, "get_connect": 65, "objective_manag": [72, 73, 74, 75], "make_run_script": [73, 74, 75], "make_observer_script": 74, "observer_wrapp": [76, 77], "start_observer_process": 77, "default": 79, "foldx": [80, 81, 395, 409, 410, 411], "foldxinterfac": 81, "mutat": [82, 83, 84, 85, 396, 436, 454], "edits_between_str": 83, "find_closest_wildtype_pdb_file_to_mut": 84, "mutations_from_wildtype_residues_and_mut": 85, "pdb_pars": [86, 87, 88, 89], "parse_pdb_as_residue_str": 87, "parse_pdb_as_residu": 88, "parse_pdb_as_structur": 89, "rasp": [90, 91, 92, 93, 94, 95, 96, 97, 98, 254, 255, 256, 257], "inner_rasp": [91, 92, 93, 94, 95, 96], "prismdata": 92, "cavity_model": 93, "helper": 94, "run_pipelin": 95, "visual": 96, "load_model": 97, "rasp_interfac": 98, "seed": [99, 100, 101, 102], "seed_numpi": 101, "seed_python": 102, "object": [103, 104, 105, 106, 394, 399, 400, 428, 430, 433, 436, 440, 441], "dynamically_instanti": 104, "parse_factory_kwarg": 105, "run": [106, 394, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 441, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "objective_factori": [107, 108, 109, 110, 111], "externalblackbox": 108, "creat": [109, 138, 430, 440], "load_config": 110, "start": [111, 393, 394], "objective_repositori": [112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341], "aloha": [116, 117, 118, 119, 400, 438], "regist": [115, 117, 118, 119, 122, 125, 128, 132, 133, 134, 137, 141, 142, 143, 146, 149, 153, 154, 155, 156, 157, 162, 163, 164, 169, 170, 171, 175, 176, 177, 209, 210, 211, 215, 216, 217, 220, 223, 226, 229, 232, 235, 238, 241, 245, 246, 247, 250, 253, 257, 260, 261, 262, 265, 266, 267, 270, 274, 278, 279, 280, 283, 286, 301, 304, 324, 325, 326, 331, 334, 336, 337, 338, 341, 391, 435, 436], "alohablackbox": 118, "alohaproblemfactori": 119, "dockstr": [129, 130, 131, 132, 133, 134, 404], "dockstringblackbox": 133, "dockstringproblemfactori": 134, "drd3_dock": [138, 139, 140, 141, 142, 143], "prerequisit": [138, 396, 397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434], "instal": [138, 391, 393, 395, 406, 409], "autodock": [138, 406], "vina": [138, 406], "adfr": [138, 406], "suit": [138, 406], "poli__lambo": 138, "environ": [138, 391, 409], "drd3blackbox": 142, "drd3problemfactori": 143, "foldx_rfp_lambo": [150, 151, 152, 153, 154, 155, 156, 157], "config": 154, "rfpwrapper": 155, "rfpwrapperfactori": 156, "get_config": 157, "foldx_sasa": [158, 159, 160, 161, 162, 163, 164], "foldx_util": [159, 166], "foldxsasablackbox": 163, "foldxsasaproblemfactori": 164, "foldx_stabl": [165, 166, 167, 168, 169, 170, 171], "foldxstabilityblackbox": 170, "foldxstabilityproblemfactori": 171, "foldx_stability_and_sasa": [172, 173, 174, 175, 176, 177], "foldxstabilityandsasablackbox": 176, "foldxstabilityandsasaproblemfactori": 177, "gfp_cba": [178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211], "abstract_vae_wrapp": [179, 180], "abstractvaewrapp": 180, "cbas_alphabet_preprocess": [181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195], "convert_aas_to_idx_arrai": 182, "convert_idx_array_to_aa": 183, "convert_mutations_to_sequ": 184, "get_argmax": 185, "get_balaji_predict": 186, "get_experimental_x_i": 187, "get_gfp_x_y_aa": 188, "get_gfp_base_seq": 189, "get_sampl": 190, "one_hot_encode_aa": 191, "one_hot_encode_aa_arrai": 192, "one_hot_encode_dna": 193, "partition_data": 194, "read_gfp_data": 195, "cbas_wrapp": [196, 197, 198, 199], "cbasvaewrapp": 197, "convertedtorchvaedecod": 198, "convertedtorchvaeencod": 199, "gfp_gp": 200, "make_va": [203, 204, 205, 206, 207, 208], "baseva": 204, "simpleva": 205, "build_va": 206, "identity_loss": 207, "summed_categorical_crossentropi": 208, "gfpcbasblackbox": 210, "gfpcbasproblemfactori": 211, "gfp_select": [212, 213, 214, 215, 216, 217], "gfpblackbox": 216, "gfpselectionproblemfactori": 217, "penalized_logp_lambo": [242, 243, 244, 245, 246, 247], "penalizedlogplamboblackbox": 246, "penalizedlogplamboproblemfactori": 247, "rdkit_logp": [258, 259, 260, 261, 262], "logpblackbox": 261, "logpproblemfactori": 262, "rdkit_q": [263, 264, 265, 266, 267], "qedblackbox": 266, "qedproblemfactori": 267, "rfp_foldx_stability_and_sasa": [268, 269, 270], "sa_tdc": [275, 276, 277, 278, 279, 280], "sablackbox": 279, "saproblemfactori": 280, "super_mario_bro": [287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301], "level_util": [289, 290, 291, 292, 293, 294, 295, 296, 297], "add_padding_to_level": 290, "clean_level": 291, "level_to_arrai": 292, "level_to_list": 293, "levels_to_onehot": 294, "onehot_to_level": 295, "tensor_to_sim_level": 296, "vector": 297, "model": [298, 299, 300], "vaemario": 299, "load_example_model": 300, "toy_continuous_problem": [305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 375, 376, 377, 378], "definit": [306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322], "ackley_function_01": 307, "alpine_01": 308, "alpine_02": 309, "bent_cigar": 310, "brown": 311, "camelback_2d": 312, "chung_reynold": 313, "cosine_mixtur": 314, "cross_in_trai": 315, "deb_01": 316, "deb_02": 317, "deflected_corrugated_spr": 318, "easom": 319, "egg_hold": 320, "shifted_spher": 321, "styblinski_tang": 322, "toycontinuousblackbox": 325, "toycontinuousproblemfactori": 326, "toycontinuousproblem": 328, "white_nois": [335, 336, 337, 338], "whitenoiseblackbox": 337, "whitenoiseproblemfactori": 338, "registered_object": 342, "test": [343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 391, 393], "docs_exampl": [347, 348, 349, 350, 351, 352, 353, 354], "test_objective_funct": [348, 349, 350, 351, 352, 353, 354], "test_aloha_exampl": 349, "test_logp_exampl": 350, "test_logp_example_using_str": 351, "test_qed_exampl": 352, "test_qed_example_using_str": 353, "test_white_noise_exampl": 354, "basic_object": [358, 359, 360, 361, 362], "test_basic_object": [359, 360, 361], "test_registering_aloha": 360, "test_registering_white_nois": 361, "test_budget_exhaust": 362, "test_chemistry_object": 364, "test_foldx": 366, "test_foldx_rfp_lambo": 367, "test_rasp": 368, "test_basic_loop_without_cr": 369, "test_force_isol": 371, "test_passing_array_of_str": 374, "test_embedding_problems_into_higher_dim": [376, 377], "test_embed_camelback_into_high_dimens": 377, "test_instancing_of_toy_continuous_problem": 378, "test_minimal_working_exampl": [381, 382], "test_seed": [383, 384], "test_seeding_in_white_nois": 384, "test_foldx_interfac": 386, "test_protein_util": 387, "api": [389, 407, 449], "document": 389, "refer": [390, 407, 442, 443, 445, 448, 449, 451, 453, 455, 456, 457], "ad": [391, 392], "new": [391, 392], "problem": [21, 391, 392, 394, 399, 430, 436, 437], "repositori": 391, "The": [391, 438, 440], "structur": 391, "A": 391, "gener": 391, "py": 391, "yml": 391, "why": 391, "conda": [391, 393], "your": [391, 393, 440], "option": 441, "make": 406, "avail": [], "depend": [], "ar": [394, 396], "met": [], "submit": [391, 392], "pull": [391, 392], "request": [391, 392], "optim": [392, 394, 427, 436, 440, 442, 444, 448, 450, 451, 455, 456, 457], "baselin": [392, 393], "an": [392, 437, 438], "abstract": [392, 437, 438], "solver": [392, 394, 436, 437, 440], "exampl": [392, 437, 438], "randommut": [392, 436, 437], "get": [393, 394], "first": 393, "script": 393, "us": [393, 394, 398, 401, 402, 403, 405, 406, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 424, 425, 426, 429, 431, 432, 434, 436, 440], "librari": 394, "discret": [394, 452], "function": [394, 399, 400, 407, 428, 430, 433, 436, 440, 441], "black": [391, 394, 433, 441], "box": [391, 394, 433, 441], "toi": [394, 399, 430], "small": [394, 399], "molecul": [394, 399], "algorithm": [394, 447, 456], "cite": [394, 397, 398, 400, 401, 402, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 429, 430, 431, 432, 433, 434], "other": [394, 396, 399], "relev": 394, "work": [394, 439], "contribut": 394, "comput": 396, "energi": 396, "singl": 396, "python": [396, 409], "set": [396, 406], "up": 396, "folder": [396, 406], "download": [396, 406], "pdb": 396, "repair": [396, 410, 411], "what": [396, 437, 440, 441], "pars": 396, "wildtyp": 396, "defin": [396, 436, 437, 438], "s": [391, 396, 448], "sasa": [396, 409], "score": 396, "conclus": [396, 438, 440], "rapid": 397, "stabil": [397, 409, 411, 436], "predict": 397, "how": [397, 398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 439, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "warn": 397, "further": 397, "read": [397, 441], "all": [399, 406, 438], "about": [398, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 437, 442, 443, 444, 445, 446, 448, 449, 451, 452, 453, 454, 455, 456, 457], "drd3": 406, "dock": [405, 406], "tdc": [398, 401, 402, 403, 405, 406, 408, 412, 413, 414, 415, 416, 417, 418, 419, 421, 424, 425, 426, 429, 431, 432, 434], "add": 406, "binari": 406, "path": 406, "prepare_receptor": 406, "from": [], "sure": 406, "you": [406, 410, 411], "re": 406, "rfp": 409, "lambo": [409, 420], "we": [394, 409, 410, 411], "can": [409, 410, 411], "automat": 409, "solvent": 410, "access": [410, 424], "penal": 420, "logp": [420, 422], "keyword": [], "argument": [], "log": [422, 438], "solubl": 422, "quantit": 423, "estim": 423, "druglik": 423, "qed": 423, "synthet": 424, "jump": 427, "super": 427, "mario": 427, "bro": 427, "therapeut": [], "data": [], "common": [], "oracl": [], "name": 428, "see": [428, 442, 443, 444, 448, 449, 452, 455, 457], "also": 428, "continu": [394, 430], "low": 430, "intrins": 430, "dimension": 430, "white": 433, "nois": 433, "observ": [435, 438], "isol": [66, 67, 68, 69, 70, 435, 441], "process": 435, "random": [436, 454], "mroug": 436, "check": 436, "result": 436, "poli_baselin": 437, "candid": 437, "want": 438, "more": [438, 441, 442, 443, 444, 448, 449, 452, 455, 457], "complex": 438, "instanc": [69, 438], "simpl": 438, "initi": 438, "put": 438, "togeth": 438, "coupl": 438, "queri": 438, "dive": 439, "deeper": 439, "doe": 439, "under": [439, 441], "hood": [439, 441], "content": [439, 440], "usual": 440, "develop": 440, "loop": 440, "identifi": 440, "own": 440, "when": [], "have": [], "right": [], "Is": [], "factori": [], "entir": [], "need": [], "where": [], "thi": 427, "call": [], "bayesian": [442, 444, 448, 450, 451, 455, 457], "cma": 446, "es": 446, "graph": 447, "genet": 447, "latent": 450, "space": 450, "line": 451, "nsga": 452, "2": [417, 452], "templat": 456, "abstract_isolated_funct": 6, "black_box_inform": 11, "tdc_isolated_funct": 15, "foldx_isolated_funct": 27, "external_black_box": 67, "external_funct": 68, "isolated_black_box": 70, "inform": [114, 121, 124, 127, 130, 136, 139, 145, 148, 151, 160, 167, 173, 201, 213, 219, 222, 225, 228, 231, 234, 237, 240, 243, 249, 252, 255, 259, 264, 269, 272, 276, 282, 285, 288, 303, 323, 330, 333, 340, 355, 356, 391, 433], "isolated_funct": [131, 140, 152, 161, 168, 174, 202, 214, 244, 256, 273, 277, 391], "test_instancing_black_boxes_alon": 372, "specifi": 391, "__init__": 391, "happen": 441, "test_black_box_instanc": 370, "test_multi_objective_and_neg": 373, "test_core_promis": 380, "cluster": 427, "albuterol_similar": [113, 114, 115], "amlodipine_mpo": [120, 121, 122], "celecoxib_rediscoveri": [123, 124, 125], "deco_hop": [126, 127, 128], "drd2_dock": [135, 136, 137], "fexofenadine_mpo": [147, 148, 149], "gsk3_beta": [218, 219, 220], "isomer_c7h8n2o2": [221, 222, 223], "isomer_c9h10n2o2pf2cl": [224, 225, 226], "jnk3": [227, 228, 229], "median_1": [230, 231, 232], "median_2": [233, 234, 235], "mestranol_similar": [236, 237, 238], "osimetrinib_mpo": [239, 240, 241], "perindopril_mpo": [248, 249, 250], "ranolazine_mpo": [251, 252, 253], "scaffold_hop": [281, 282, 283], "sitagliptin_mpo": [284, 285, 286], "thiothixene_rediscoveri": [302, 303, 304], "troglitazone_rediscoveri": [329, 330, 331], "valsartan_smart": [332, 333, 334], "zaleplon_mpo": [339, 340, 341], "albuterol": 398, "similar": [398, 418], "drd2": 405, "gsk3\u03b2": 412, "mestranol": 418, "celecoxib": 402, "rediscoveri": [402, 429, 431], "thiothixen": 429, "troglitazon": 431, "amlodipin": 401, "mpo": [401, 408, 419, 421, 426, 434], "fexofenadin": 408, "osimetrinib": 419, "ranolazin": 421, "sitagliptin": 426, "zaleplon": 434, "deco": 403, "hop": [403, 425], "scaffold": 425, "isom": [413, 414], "c7h8n2o2": 413, "c9h10n2o2pf2cl": 414, "median": [416, 417], "1": 416, "valsartan": 432, "smart": 432, "c": 415, "jun": 415, "n": 415, "termin": 415, "kinas": 415, "3": 415, "abstract_benchmark": 2, "benchmark_inform": 10, "benchmark": [344, 345, 394], "test_benchmark_cr": 345, "hvarfner": 448, "vanilla": 448, "spars": 455, "axi": 455, "subspac": [443, 455], "saasbo": 455, "multi_observ": 71, "alebo": 442, "adapt": [442, 443], "linear": 442, "embed": 442, "trust": 457, "region": 457, "turbo": 457, "expand": 443, "baxu": 443, "bounc": 445, "probabilist": 453, "reparametr": 453, "algorithm_observer_wrapp": 40, "default_observ": 53, "ehrlich": [144, 145, 146, 407], "rmf_landscap": [271, 272, 273, 274], "conftest": 346, "toy_discrete_problem": 379, "test_dynamic_inform": 356, "lambo2": 449}, "envversion": {"sphinx.domains.c": 2, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 6, "sphinx.domains.index": 1, "sphinx.domains.javascript": 2, "sphinx.domains.math": 2, "sphinx.domains.python": 3, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.intersphinx": 1, "sphinxcontrib.bibtex": 9, "sphinx": 56}}) \ No newline at end of file diff --git a/understanding_foldx/00-installing-foldx.html b/understanding_foldx/00-installing-foldx.html index 1bbf960d..ddaefa8b 100644 --- a/understanding_foldx/00-installing-foldx.html +++ b/understanding_foldx/00-installing-foldx.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/understanding_foldx/01-single-mutation-using-foldx/index.html b/understanding_foldx/01-single-mutation-using-foldx/index.html index 23c1c5e8..38e59ad2 100644 --- a/understanding_foldx/01-single-mutation-using-foldx/index.html +++ b/understanding_foldx/01-single-mutation-using-foldx/index.html @@ -226,6 +226,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/RaSP.html b/using_poli/objective_repository/RaSP.html index fcccce41..668f2d79 100644 --- a/using_poli/objective_repository/RaSP.html +++ b/using_poli/objective_repository/RaSP.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/albuterol_similarity.html b/using_poli/objective_repository/albuterol_similarity.html index b50f1de2..1443b087 100644 --- a/using_poli/objective_repository/albuterol_similarity.html +++ b/using_poli/objective_repository/albuterol_similarity.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/all_objectives.html b/using_poli/objective_repository/all_objectives.html index 0ee97027..2533b590 100644 --- a/using_poli/objective_repository/all_objectives.html +++ b/using_poli/objective_repository/all_objectives.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/aloha.html b/using_poli/objective_repository/aloha.html index e4966161..762842e1 100644 --- a/using_poli/objective_repository/aloha.html +++ b/using_poli/objective_repository/aloha.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/amlodipine_mpo.html b/using_poli/objective_repository/amlodipine_mpo.html index 48a17669..c3d2996c 100644 --- a/using_poli/objective_repository/amlodipine_mpo.html +++ b/using_poli/objective_repository/amlodipine_mpo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/celecoxib_rediscovery.html b/using_poli/objective_repository/celecoxib_rediscovery.html index 73e93ecd..e2a52de7 100644 --- a/using_poli/objective_repository/celecoxib_rediscovery.html +++ b/using_poli/objective_repository/celecoxib_rediscovery.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/deco_hop.html b/using_poli/objective_repository/deco_hop.html index 901faca0..2b2ef0b7 100644 --- a/using_poli/objective_repository/deco_hop.html +++ b/using_poli/objective_repository/deco_hop.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/dockstring.html b/using_poli/objective_repository/dockstring.html index 97fdb4f9..5a86b24c 100644 --- a/using_poli/objective_repository/dockstring.html +++ b/using_poli/objective_repository/dockstring.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/drd2_docking.html b/using_poli/objective_repository/drd2_docking.html index 575f78db..9da3c752 100644 --- a/using_poli/objective_repository/drd2_docking.html +++ b/using_poli/objective_repository/drd2_docking.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/drd3_docking.html b/using_poli/objective_repository/drd3_docking.html index b04f6043..a69d462e 100644 --- a/using_poli/objective_repository/drd3_docking.html +++ b/using_poli/objective_repository/drd3_docking.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/ehrlich_functions.html b/using_poli/objective_repository/ehrlich_functions.html index 819d36b1..cefa64a0 100644 --- a/using_poli/objective_repository/ehrlich_functions.html +++ b/using_poli/objective_repository/ehrlich_functions.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/fexofenadine_mpo.html b/using_poli/objective_repository/fexofenadine_mpo.html index 24e466e1..e94f5697 100644 --- a/using_poli/objective_repository/fexofenadine_mpo.html +++ b/using_poli/objective_repository/fexofenadine_mpo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/foldx_rfp_lambo.html b/using_poli/objective_repository/foldx_rfp_lambo.html index f815df14..935226e2 100644 --- a/using_poli/objective_repository/foldx_rfp_lambo.html +++ b/using_poli/objective_repository/foldx_rfp_lambo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/foldx_sasa.html b/using_poli/objective_repository/foldx_sasa.html index 2c6e9c88..2ab3b596 100644 --- a/using_poli/objective_repository/foldx_sasa.html +++ b/using_poli/objective_repository/foldx_sasa.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/foldx_stability.html b/using_poli/objective_repository/foldx_stability.html index cd00ebb5..d10c9a64 100644 --- a/using_poli/objective_repository/foldx_stability.html +++ b/using_poli/objective_repository/foldx_stability.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/gsk3_beta.html b/using_poli/objective_repository/gsk3_beta.html index 797acdf5..cabf1829 100644 --- a/using_poli/objective_repository/gsk3_beta.html +++ b/using_poli/objective_repository/gsk3_beta.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/isomer_c7h8n2o2.html b/using_poli/objective_repository/isomer_c7h8n2o2.html index 630301ae..b7406083 100644 --- a/using_poli/objective_repository/isomer_c7h8n2o2.html +++ b/using_poli/objective_repository/isomer_c7h8n2o2.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/isomer_c9h10n2o2pf2cl.html b/using_poli/objective_repository/isomer_c9h10n2o2pf2cl.html index bd342af6..7eeca9a2 100644 --- a/using_poli/objective_repository/isomer_c9h10n2o2pf2cl.html +++ b/using_poli/objective_repository/isomer_c9h10n2o2pf2cl.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/jnk3.html b/using_poli/objective_repository/jnk3.html index e5dec9cd..bbef0ec9 100644 --- a/using_poli/objective_repository/jnk3.html +++ b/using_poli/objective_repository/jnk3.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/median_1.html b/using_poli/objective_repository/median_1.html index f7fca77c..eeb9a5e5 100644 --- a/using_poli/objective_repository/median_1.html +++ b/using_poli/objective_repository/median_1.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/median_2.html b/using_poli/objective_repository/median_2.html index 34eabb34..9ca161d4 100644 --- a/using_poli/objective_repository/median_2.html +++ b/using_poli/objective_repository/median_2.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/mestranol_similarity.html b/using_poli/objective_repository/mestranol_similarity.html index 234f1201..707c10ce 100644 --- a/using_poli/objective_repository/mestranol_similarity.html +++ b/using_poli/objective_repository/mestranol_similarity.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/osimetrinib_mpo.html b/using_poli/objective_repository/osimetrinib_mpo.html index b386d584..be3c8e3e 100644 --- a/using_poli/objective_repository/osimetrinib_mpo.html +++ b/using_poli/objective_repository/osimetrinib_mpo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/penalized_logp_lambo.html b/using_poli/objective_repository/penalized_logp_lambo.html index b41dde92..660e8d1e 100644 --- a/using_poli/objective_repository/penalized_logp_lambo.html +++ b/using_poli/objective_repository/penalized_logp_lambo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/ranolazine_mpo.html b/using_poli/objective_repository/ranolazine_mpo.html index 2a7e4f6b..a5ad866a 100644 --- a/using_poli/objective_repository/ranolazine_mpo.html +++ b/using_poli/objective_repository/ranolazine_mpo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/rdkit_logp.html b/using_poli/objective_repository/rdkit_logp.html index 211cc1c4..fc3d8f37 100644 --- a/using_poli/objective_repository/rdkit_logp.html +++ b/using_poli/objective_repository/rdkit_logp.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/rdkit_qed.html b/using_poli/objective_repository/rdkit_qed.html index 4392dbdb..306aa123 100644 --- a/using_poli/objective_repository/rdkit_qed.html +++ b/using_poli/objective_repository/rdkit_qed.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/sa_tdc.html b/using_poli/objective_repository/sa_tdc.html index 24430429..0272715d 100644 --- a/using_poli/objective_repository/sa_tdc.html +++ b/using_poli/objective_repository/sa_tdc.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/scaffold_hop.html b/using_poli/objective_repository/scaffold_hop.html index 1a5553d4..f7c470f9 100644 --- a/using_poli/objective_repository/scaffold_hop.html +++ b/using_poli/objective_repository/scaffold_hop.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/sitagliptin_mpo.html b/using_poli/objective_repository/sitagliptin_mpo.html index a49212d4..801c6288 100644 --- a/using_poli/objective_repository/sitagliptin_mpo.html +++ b/using_poli/objective_repository/sitagliptin_mpo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/super_mario_bros.html b/using_poli/objective_repository/super_mario_bros.html index dcd93b2c..c8a9cb8b 100644 --- a/using_poli/objective_repository/super_mario_bros.html +++ b/using_poli/objective_repository/super_mario_bros.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/template.html b/using_poli/objective_repository/template.html index 29e819de..b84b8e69 100644 --- a/using_poli/objective_repository/template.html +++ b/using_poli/objective_repository/template.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/thiothixene_rediscovery.html b/using_poli/objective_repository/thiothixene_rediscovery.html index 1e34df8a..541a5911 100644 --- a/using_poli/objective_repository/thiothixene_rediscovery.html +++ b/using_poli/objective_repository/thiothixene_rediscovery.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/toy_continuous_problems.html b/using_poli/objective_repository/toy_continuous_problems.html index 00478dea..b03ae5c1 100644 --- a/using_poli/objective_repository/toy_continuous_problems.html +++ b/using_poli/objective_repository/toy_continuous_problems.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/troglitazone_rediscovery.html b/using_poli/objective_repository/troglitazone_rediscovery.html index dda616d0..b2f4ec2e 100644 --- a/using_poli/objective_repository/troglitazone_rediscovery.html +++ b/using_poli/objective_repository/troglitazone_rediscovery.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/valsartan_smarts.html b/using_poli/objective_repository/valsartan_smarts.html index dab55cf7..264f1bba 100644 --- a/using_poli/objective_repository/valsartan_smarts.html +++ b/using_poli/objective_repository/valsartan_smarts.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/white_noise.html b/using_poli/objective_repository/white_noise.html index fc59b3e8..3e3f2438 100644 --- a/using_poli/objective_repository/white_noise.html +++ b/using_poli/objective_repository/white_noise.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/objective_repository/zaleplon_mpo.html b/using_poli/objective_repository/zaleplon_mpo.html index 1179572e..65c53522 100644 --- a/using_poli/objective_repository/zaleplon_mpo.html +++ b/using_poli/objective_repository/zaleplon_mpo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/observers/registering_an_observer.html b/using_poli/observers/registering_an_observer.html index ccc8cf50..1bfea254 100644 --- a/using_poli/observers/registering_an_observer.html +++ b/using_poli/observers/registering_an_observer.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability.html b/using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability.html index 86c1f8fe..aa369793 100644 --- a/using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability.html +++ b/using_poli/optimization_examples/protein-stability-foldx/optimizing_protein_stability.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/the_basics/defining_a_problem_solver.html b/using_poli/the_basics/defining_a_problem_solver.html index 7f1e607c..d0dadc4f 100644 --- a/using_poli/the_basics/defining_a_problem_solver.html +++ b/using_poli/the_basics/defining_a_problem_solver.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/the_basics/defining_an_observer.html b/using_poli/the_basics/defining_an_observer.html index 0eaa9ce7..06e7615d 100644 --- a/using_poli/the_basics/defining_an_observer.html +++ b/using_poli/the_basics/defining_an_observer.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/the_basics/diving_deeper.html b/using_poli/the_basics/diving_deeper.html index 46692c2e..ca792afe 100644 --- a/using_poli/the_basics/diving_deeper.html +++ b/using_poli/the_basics/diving_deeper.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/the_basics/intro_to_poli.html b/using_poli/the_basics/intro_to_poli.html index 65c26fa4..d6cf5ba1 100644 --- a/using_poli/the_basics/intro_to_poli.html +++ b/using_poli/the_basics/intro_to_poli.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli/the_basics/isolation.html b/using_poli/the_basics/isolation.html index 47757c00..60782eda 100644 --- a/using_poli/the_basics/isolation.html +++ b/using_poli/the_basics/isolation.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/alebo.html b/using_poli_baselines/alebo.html index fd9062ce..c131f52b 100644 --- a/using_poli_baselines/alebo.html +++ b/using_poli_baselines/alebo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/baxus.html b/using_poli_baselines/baxus.html index 1506817f..3025b452 100644 --- a/using_poli_baselines/baxus.html +++ b/using_poli_baselines/baxus.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/bayesian_optimization.html b/using_poli_baselines/bayesian_optimization.html index fb81ff02..a1b744d1 100644 --- a/using_poli_baselines/bayesian_optimization.html +++ b/using_poli_baselines/bayesian_optimization.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/bounce.html b/using_poli_baselines/bounce.html index 536445c8..e09a62a2 100644 --- a/using_poli_baselines/bounce.html +++ b/using_poli_baselines/bounce.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/cma_es.html b/using_poli_baselines/cma_es.html index 297028eb..2d49f777 100644 --- a/using_poli_baselines/cma_es.html +++ b/using_poli_baselines/cma_es.html @@ -229,6 +229,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/graph_ga.html b/using_poli_baselines/graph_ga.html index 47b799cf..c546aa5f 100644 --- a/using_poli_baselines/graph_ga.html +++ b/using_poli_baselines/graph_ga.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/hvarfners_vanilla_bo.html b/using_poli_baselines/hvarfners_vanilla_bo.html index cfe455c2..3bf32cad 100644 --- a/using_poli_baselines/hvarfners_vanilla_bo.html +++ b/using_poli_baselines/hvarfners_vanilla_bo.html @@ -67,7 +67,7 @@ - + @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • @@ -831,12 +832,12 @@

        References

        previous

        -

        Line Bayesian Optimization

        +

        LaMBO2

         + + + + + + + + + LaMBO2 — Documentation for poli and poli-baselines + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
        + + + + + + + + + + +
        +
        +
        +
        + + + Ctrl+K +
        +
        + +
        +
        + + +
        +
        + + + +
        + + + +
        + + + + +
        + +
        +
        + + + +
        +
        +
        + + +
        +
        + + + + +
        + +
        + + + +
        + +
        +
        + +
        +
        + +
        + +
        + +
        + + +
        + +
        + +
        + + + + + +
        + + +
        + + + + + + +
        + + +
        + + + + + + + + + + + + + +
        + +
        + +
        +
        + + + +
        +

        LaMBO2

        + +
        +
        + +
        +

        Contents

        +
        + +
        +
        +
        + + + + +
        + +
        +

        LaMBO2#

        +

        Type of optimizer algorithm: proteins only +LaMBO2 (py3.10 in conda)

        +
        +

        About#

        +

        This is an implementation of LaMBO2 as described in [Gruver et al., 2024]. We use the official GitHub implementation provided by Genentech underneath.

        +
        +

        Note

        +

        A tutorial on optimizing thermal stability of RFP proteins is available in poli-baselines’ repository.

        +

        Another minimal example is available on Colab.

        +
        +
        +
        +

        How to run#

        +
        +

        Warning

        +

        This solver runs in a different conda environment than base. You will have to install cortex to run it:

        +
        pip install pytorch-cortex
+
        +
        +
        +
        import numpy as np
+
+from poli.objective_repository import EhrlichProblemFactory
+
+from poli_baselines.solvers.bayesian_optimization.lambo2 import (
+    LaMBO2,
+)
+
+problem = EhrlichProblemFactory().create(
+    sequence_length=10,
+    motif_length=4,
+    n_motifs=2,
+    return_value_on_unfeasible=-1.0
+)
+f, x0 = problem.black_box, problem.x0
+
+solver = LaMBO2(
+    black_box=f,
+    x0=x0,
+)
+
        +
        +
        +
        +

        See more#

        + +
        +
        +

        References#

        +

        If you use this solver, we expect that you cite the following resources:

        +
        + +
        +

        [1] Gruver, N., Stanton, S., Frey, N., Rudner, T. G. J., Hotzel, I., Lafrance-Vanasse, J., Rajpal, A., Cho, K., & Wilson, A. G. (2024). Protein design with guided discrete diffusion. Advances in Neural Information Processing Systems, 36.

        +

        [2] González-Duque, M., Bartels, S., & Michael, R. (2024). poli: a libary of discrete sequence objectives [Computer software]. MachineLearningLifeScience/poli

        +
        + +
        +
        
+@article{Gruver:Lambo2:2024,
+  title={Protein design with guided discrete diffusion},
+  author={Gruver, Nate and Stanton, Samuel and Frey, Nathan and Rudner, Tim GJ and Hotzel, Isidro and Lafrance-Vanasse, Julien and Rajpal, Arvind and Cho, Kyunghyun and Wilson, Andrew G},
+  journal={Advances in Neural Information Processing Systems},
+  volume={36},
+  year={2024}
+}
+
+
+@software{Gonzalez-Duque:poli:2024,
+author = {González-Duque, Miguel and Bartels, Simon and Michael, Richard},
+month = jan,
+title = {{poli: a libary of discrete sequence objectives}},
+url = {https://github.com/MachineLearningLifeScience/poli},
+version = {0.0.1},
+year = {2024}
+}
+
+
        +
        +
        +
        +
        +
        +

        API reference#

        +
        +
        +class poli_baselines.solvers.bayesian_optimization.lambo2.LaMBO2(black_box: AbstractBlackBox, x0: np.ndarray | None = None, y0: np.ndarray | None = None, config_dir: Path | str | None = None, config_name: str = 'generic_training', overrides: list[str] | None = None, seed: int | None = None, max_epochs_for_retraining: int = 1)#
        +

        LaMBO2 solver for protein-related black boxes.

        +
        +
        Parameters
        +
          +

        • black_box (AbstractBlackBox) – The black box to optimize. Must be protein-related. To ensure that the +black box is protein-related, we verify that the alphabet inside the +info attribute of the black box is a protein alphabet.

          • +

        • x0 (np.ndarray) – The initial solutions to the black box. If not enough solutions are +provided, the solver will generate random mutants to reach the population +size specified in the configuration file (as cfg.num_samples).

          • +

        • y0 (np.ndarray, optional) – The initial evaluations of the black box. If not provided, the solver +will evaluate the black box on the initial solutions.

          • +

        • config_dir (Path | str, optional) – The directory where the configuration files are stored. If not provided, +the default configuration files (stored alongside this file in our +repository) will be used. If you are interested in modifying the +configurations, we recommend taking a look at the tutorials inside cortex.

          • +

        • config_name (str, optional) – The name of the configuration file to use. Defaults to “generic_training”.

          • +

        • overrides (list[str], optional) – A list of overrides to apply to the configuration file. For example, +[“num_samples=10”, “max_epochs=5”]. To know what to override, we recommend +taking a look at the tutorials inside cortex.

          • +

        • seed (int, optional) – The random seed to use. If not provided, we use the seed provided in the +configuration file. If provided, this seed will override the seed in the +configuration file.

          • +

        • max_epochs_for_retraining (int, optional) – The number of epochs to retrain the model after each step. Defaults to 1.

          • +
        +
        +
        +
        +
        +get_candidate_points_from_history() → ndarray#
        +

        Returns the current best population (whose size is specified in the +configuration file as cfg.num_samples) from the history of the black +box evaluations.

        +
        + +
        +
        +property history: dict[str, list[numpy.ndarray]]#
        +

        Returns the history of the black box evaluations.

        +
        +
        Returns
        +

        The history of the black box evaluations.

        +
        +
        Return type
        +

        dict[str, list[np.ndarray]]

        +
        +
        +
        + +
        +
        +solve(max_iter: int = 10) → None#
        +

        Solves the black box optimization problem for a maximum of max_iter +iterations.

        +
        +
        Parameters
        +

        max_iter (int, optional) – The maximum number of iterations to run the solver. Defaults to 10.

        +
        +
        +
        + +
        +
        +step() → tuple[numpy.ndarray, numpy.ndarray]#
        +

        Loads the model, runs the optimizer (LaMBO2) for the +number of steps in the config, computes new proposal, +evaluates on the black box and updates history.

        +
        + +
        + +
        +
        + + + + +
        + + + + + + + + +
        + + + +
        + + +
        +
        + Contents +
        +
        + +
        + + +
        +
        + +
        + +
        + +

        +By Center for Basic Machine Learning Research in Life Science +

        + +
        + +
        + + +

        + + © Copyright 2022. +
        + +

        + +
        + +
        + +
        + +
        + +
        + +
        +
        + + +
        +
        +
        + + + + + +
        +
        + + \ No newline at end of file diff --git a/using_poli_baselines/latent_space_bo.html b/using_poli_baselines/latent_space_bo.html index 1832fdba..a15f5d4b 100644 --- a/using_poli_baselines/latent_space_bo.html +++ b/using_poli_baselines/latent_space_bo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/line_bayesian_optimization.html b/using_poli_baselines/line_bayesian_optimization.html index 491d5e5e..4f3e1237 100644 --- a/using_poli_baselines/line_bayesian_optimization.html +++ b/using_poli_baselines/line_bayesian_optimization.html @@ -66,7 +66,7 @@ - + @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • @@ -826,11 +827,11 @@

        References

        next

        -

        Hvarfner’s Vanilla Bayesian Optimization

        +

        LaMBO2

         diff --git a/using_poli_baselines/nsga_2.html b/using_poli_baselines/nsga_2.html index 3dbdf128..abcfed57 100644 --- a/using_poli_baselines/nsga_2.html +++ b/using_poli_baselines/nsga_2.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/probrep.html b/using_poli_baselines/probrep.html index c403c41f..6aeb4e01 100644 --- a/using_poli_baselines/probrep.html +++ b/using_poli_baselines/probrep.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/random_mutations.html b/using_poli_baselines/random_mutations.html index d7ef3510..50328dc1 100644 --- a/using_poli_baselines/random_mutations.html +++ b/using_poli_baselines/random_mutations.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/saasbo.html b/using_poli_baselines/saasbo.html index 5d2ec8b1..92c85a6d 100644 --- a/using_poli_baselines/saasbo.html +++ b/using_poli_baselines/saasbo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/template.html b/using_poli_baselines/template.html index 13794bf2..7985e568 100644 --- a/using_poli_baselines/template.html +++ b/using_poli_baselines/template.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)
        • diff --git a/using_poli_baselines/turbo.html b/using_poli_baselines/turbo.html index fa6cd8df..c37d6247 100644 --- a/using_poli_baselines/turbo.html +++ b/using_poli_baselines/turbo.html @@ -227,6 +227,7 @@
      • Random mutations
      • CMA-ES
      • Line Bayesian Optimization
        • +
      • LaMBO2
      • Hvarfner’s Vanilla Bayesian Optimization
      • Sparse Axis-Aligned Subspaces Bayesian Optimization (SAASBO)
      • Adaptive Linear Embedding Bayesian Optimization (ALEBO)